Eleusine indica associated virus


Basic Information

Genus Mastrevirus
NCBI Assembly GCF_018585455.1
Isolate Reunion
Release date 2021/6/1
Submitter Claverie,S., Ouattara,A., Hoarau,M., Filloux,D., Varsani,A., Roumagnac,P., Martin,D.P., Lett,J.M., Lefeuvre,P.
Host
Vector
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_055572
ACGATTTGGCCCGTGAAGCGACGGCCGCCGTGTGCGCTCTACGGCGGACGGAGCGGTAGGCAAAGATGCTGCTTTGCACGAAATGTCGTTGTCTGTCTTTAATAATTGATGCTTTACGCGTCATTCTTTATAAAAGAAGGGGGCCCACACACAGCTTTAAGATGGGGAGGGCATCGCACTATCAGGTATTCACTCCTTCGTCCTCCTGGGTTGTGTCCCAATCTCCTCCCGAGGTCGTGGCGAGCTCGGATCCGTGGTTCCGCGTGATATATATCTTGGTTATTTCCCTAATTATTTTAGGGACTATATACCTTGCCTATCGGTGGTTCATACGTGATGTCGTCATACTGTTTAGGGCGAAGAGACAGCGGAGCACGGAAGAGATTGGTTTCGGCAATACTCCAGCTCGGGCCGACGGTGGATTCTCTCTCACCGGACGAGGAACTGCTTCCGCGGCTCCAGTTCCTCCTGTCTAGGGCTCTTCTCCTGCTTGAGGAGGTAGAGGCCGATGGCGAAGGTGATGAAACGCAAGAGGTCCCGTCCGGGGGACGAGGTAGCCTGGACCAAGCGGTCAAGGTGGAGCGCTTCGAAGGTTCCTTCCAAGGGAAGCACTAGTAGGACTAGGGTACGTCCTAGTCTTCAGATACAGGAGCTGGTACAGACAGGTAACAGTAAGTTGGAGGTTAAAAATGGTGGATCGTGCCTTCTTCTTGGCACGTTCGCACGTGGCGCTGATGAGGGTCAGCGACACACAAACGAGACTATGATATACAAGGTTGCCATAGACATGCATTTCTCTGTGACAGCAGCGGCTGCAGCGTACTCTAACCAGGGTACTGGGGTCGTTTGGTTGATCTATGATTCACAGCCGACCGGAACTCAGCCCACTCTGAAGGATATCTTCGCCTATGATACCAACCAGGTATCGTGGCCTTACCTTTGGAAGGTTTCAAGGGAGGCGTGTCATAGGTTCGTCGTGAAGAGACGTTACACGTTCTACCTGGAGACGAATGGAAGGAGGAACGATGAGGTTCCACCCCAGAATGCAGTCTGGGCTCCATGTAAAACTAGTTGTTACTTCCACAAGTTTGCTAAAGGGTTAGGTGTGCGAACTGAGTGGAAGAACAACACAGACGGGGGCATTGGGTCGATTAAGAAAGGTGCGTTGTATTTTGCCATAGCACCTGGCAATGGGATAGAGTTTAATCTTTTTGGAAGGAACCGTCTGTACTTCAAATCTATTGGTAATCAATAAGATATGTATGGAATGTTATTATTATAATGACATTTGGTTGTCAAGAAATAAGACAAAAACATACTCGGCGGCAGATCGTGGCGGCTATGGGATAGCGAAGGAAAAAAACACCCGGAAAAAACTCAGCTTTGTGAAAATGGTCAGCGCGTCGTCGAGCTTGCGAGTGACGCTGTAGCTGACACGGCTGGCCGCTTAGGCTAAGAAAAGAATCGTTCACCCGATTCCATTACATAGATGTCACAATTACATTCAAAATACTCCAGCTGTGCTGGAGTCATACATTTCATCCAATCCTCATCATTATTTACTAATATGATGCTAGGAATTCCTCCAGGAATTCATTTCTTCTTCCCGTACTTGGGGTTGACGGTGAAGTCTCGTTGGCCCCCGACCAGCTGTTTCCAACAGGGGCAGAACTTGAAGGGTATGTCGTCGATGACGTTATACTTAGCGTCCTTGTTGTAGCATGTGAAATCGACGCAGTTCTGCCAGTAGTTATGATGGGAAGGAGCTATGCTCCTGGCCCATGTTGTCTTACCGGTCCTTGTTGGACCGACGATGTAGAGGCTCCTTGGTCGAGAAGGCCTTTCTGCAGCATCTCCCTAGATGTGTTGTGCATCCAGTAGAGATCGTTAACAGCCTGCTCAATTGTTACCACATGTGGTGAATGAACCATGTAGACATACGGATGTACCTGATAGATGTTTTCGGTCATCCATGTTTCAATGGTCTCGTAACAATGGAGGTCGGGTGTGGTAACTGGATGAGGAGGGATGAATGGAGCCTCTGTTGTTGGAAACAACCTCTCGGCTGAGTATTCGAAATGCTGTAATTTCGTGGCCCAGTCGAATGGGAAGGCTTTCTGCACCATGGATAAATCCCCCCCTGGGGATAAATACTCCCCTCTCATACTTAGTGATTGGATTCTTAAGGATATACTCTCTAGTTTTATTTGGAGAGCGTGAAGGCTGGATGTTAGGGTGATGACCCTGAATGTCAAAAAAACTAGGATCCCTAGTTTTAACAGGCTTATCAGTTTGGAGAAGACAGTGGAGATGAGGAGTATTATCCTGGTGGAACTCAGAAGAAATAATAATATAAATAGGATTGTAAGGACGTGCCTTACCCCAGAGAAATTCACCTGCTTCCTGCGGTGAAACGGAGCAGTGTGGATAGGTGAGGAAGATGTTGGCGCTTCGGAGATGGAATGAACGGCTAGTGGACCCGACATGGAAGTCTCTGACGGACTGGTGGGGCAGAGATGGCAGAGAGTCAGATGAACTCATCGTTTCTCTGGTGGTCTTCTGGCGGCTTAGCAACTAACCGTCAGCTCCGCTGCGCGAACTCTATGATACGATTTGGTTCGTGTTCGTGCTCACCCCCGTGCCTTAAAGAGTGTGCTGGATGGGCCCTATTGGGCCCGCCTGTCGCGATCACGGGCCAAATCCTTTTAATATT

Gene Information

NCBI Accession YP_010087738.1
Location 66-476
Protein Name movement protein
Coding Region ATGCTGCTTTGCACGAAATGTCGTTGTCTGTCTTTAATAATTGATGCTTTACGCGTCATTCTTTATAAAAGAAGGGGGCCCACACACAGCTTTAAGATGGGGAGGGCATCGCACTATCAGGTATTCACTCCTTCGTCCTCCTGGGTTGTGTCCCAATCTCCTCCCGAGGTCGTGGCGAGCTCGGATCCGTGGTTCCGCGTGATATATATCTTGGTTATTTCCCTAATTATTTTAGGGACTATATACCTTGCCTATCGGTGGTTCATACGTGATGTCGTCATACTGTTTAGGGCGAAGAGACAGCGGAGCACGGAAGAGATTGGTTTCGGCAATACTCCAGCTCGGGCCGACGGTGGATTCTCTCTCACCGGACGAGGAACTGCTTCCGCGGCTCCAGTTCCTCCTGTCTAG
Protein Sequence MLLCTKCRCLSLIIDALRVILYKRRGPTHSFKMGRASHYQVFTPSSSWVVSQSPPEVVASSDPWFRVIYILVISLIILGTIYLAYRWFIRDVVILFRAKRQRSTEEIGFGNTPARADGGFSLTGRGTASAAPVPPV

NCBI Accession YP_010087739.1
Location 509-1255
Protein Name coat protein
Coding Region ATGGCGAAGGTGATGAAACGCAAGAGGTCCCGTCCGGGGGACGAGGTAGCCTGGACCAAGCGGTCAAGGTGGAGCGCTTCGAAGGTTCCTTCCAAGGGAAGCACTAGTAGGACTAGGGTACGTCCTAGTCTTCAGATACAGGAGCTGGTACAGACAGGTAACAGTAAGTTGGAGGTTAAAAATGGTGGATCGTGCCTTCTTCTTGGCACGTTCGCACGTGGCGCTGATGAGGGTCAGCGACACACAAACGAGACTATGATATACAAGGTTGCCATAGACATGCATTTCTCTGTGACAGCAGCGGCTGCAGCGTACTCTAACCAGGGTACTGGGGTCGTTTGGTTGATCTATGATTCACAGCCGACCGGAACTCAGCCCACTCTGAAGGATATCTTCGCCTATGATACCAACCAGGTATCGTGGCCTTACCTTTGGAAGGTTTCAAGGGAGGCGTGTCATAGGTTCGTCGTGAAGAGACGTTACACGTTCTACCTGGAGACGAATGGAAGGAGGAACGATGAGGTTCCACCCCAGAATGCAGTCTGGGCTCCATGTAAAACTAGTTGTTACTTCCACAAGTTTGCTAAAGGGTTAGGTGTGCGAACTGAGTGGAAGAACAACACAGACGGGGGCATTGGGTCGATTAAGAAAGGTGCGTTGTATTTTGCCATAGCACCTGGCAATGGGATAGAGTTTAATCTTTTTGGAAGGAACCGTCTGTACTTCAAATCTATTGGTAATCAATAA
Protein Sequence MAKVMKRKRSRPGDEVAWTKRSRWSASKVPSKGSTSRTRVRPSLQIQELVQTGNSKLEVKNGGSCLLLGTFARGADEGQRHTNETMIYKVAIDMHFSVTAAAAAYSNQGTGVVWLIYDSQPTGTQPTLKDIFAYDTNQVSWPYLWKVSREACHRFVVKRRYTFYLETNGRRNDEVPPQNAVWAPCKTSCYFHKFAKGLGVRTEWKNNTDGGIGSIKKGALYFAIAPGNGIEFNLFGRNRLYFKSIGNQ

NCBI Accession YP_010087740.1
Location 1767-2486
Protein Name RepA
Coding Region ATGTCGGGTCCACTAGCCGTTCATTCCATCTCCGAAGCGCCAACATCTTCCTCACCTATCCACACTGCTCCGTTTCACCGCAGGAAGCAGGTGAATTTCTCTGGGGTAAGGCACGTCCTTACAATCCTATTTATATTATTATTTCTTCTGAGTTCCACCAGGATAATACTCCTCATCTCCACTGTCTTCTCCAAACTGATAAGCCTGTTAAAACTAGGGATCCTAGTTTTTTTGACATTCAGGGTCATCACCCTAACATCCAGCCTTCACGCTCTCCAAATAAAACTAGAGAGTATATCCTTAAGAATCCAATCACTAAGTATGAGAGGGGAGTATTTATCCCCAGGGGGGGATTTATCCATGGTGCAGAAAGCCTTCCCATTCGACTGGGCCACGAAATTACAGCATTTCGAATACTCAGCCGAGAGGTTGTTTCCAACAACAGAGGCTCCATTCATCCCTCCTCATCCAGTTACCACACCCGACCTCCATTGTTACGAGACCATTGAAACATGGATGACCGAAAACATCTATCAGGTACATCCGTATGTCTACATGGTTCATTCACCACATGTGGTAACAATTGAGCAGGCTGTTAACGATCTCTACTGGATGCACAACACATCTAGGGAGATGCTGCAGAAAGGCCTTCTCGACCAAGGAGCCTCTACATCGTCGGTCCAACAAGGACCGGTAAGACAACATGGGCCAGGAGCATAG
Protein Sequence MSGPLAVHSISEAPTSSSPIHTAPFHRRKQVNFSGVRHVLTILFILLFLLSSTRIILLISTVFSKLISLLKLGILVFLTFRVITLTSSLHALQIKLESISLRIQSLSMRGEYLSPGGDLSMVQKAFPFDWATKLQHFEYSAERLFPTTEAPFIPPHPVTTPDLHCYETIETWMTENIYQVHPYVYMVHSPHVVTIEQAVNDLYWMHNTSREMLQKGLLDQGASTSSVQQGPVRQHGPGA

References More References in PubMed

1

A high degree of African streak virus diversity within Nigerian maize fields includes a new mastrevirus from Axonopus compressus.

Oluwafemi S, et al.  Arch Virol. 2014 Oct;159(10):2765-70. doi: 10.1007/s00705-014-2090-7. Epub 2014 May 6.

PMID: 24796552

2

An Immunity (QL3) Breaking Strain of Sorghum Mosaic Potyvirus in India.

Mali VR.  Plant Dis. 1999 Sep;83(9):877. doi: 10.1094/PDIS.1999.83.9.877B.

PMID: 30841052