| Abbreviation | ToLCuINB |
|---|---|
| Genebank Accession | JQ012916 |
| Isolate | IN-AC1S1-11 |
| Download | Genome |GFF3 |PEP |CDS |
| NCBI Accession | AET50436.1 |
|---|---|
| Location | 182-538 |
| Protein Name | C1 protein |
| Coding Region | ATGACGAGGAGCGGAACAAACAAGCAGGGAGTCCGATTCACGGTCGACGTACGCATCATGGACGGCATGAAGCTCTTCATTCACATGCGACTCGTATCGACCAAGACACCGGCAATCATCAAGTACGAAGGGGTCATCAAATACATGTACGGGAACATGCACATTCCATTCGACTTCAACGGATTCGAAGGGAACATCATCGCGAATTTCTTATTCGCCAACAACGGGGCCAACATCGAGGAGATCGAGATAGAAGACATAATCGAAAGGCTCGATATACTTGTACTTCAAAACCCCGAGATTGAGGGGATGGATGTAATCGAACCCTATATATTCAATAAGAGGTTCACCGTTTAA |
| Protein Sequence | MTRSGTNKQGVRFTVDVRIMDGMKLFIHMRLVSTKTPAIIKYEGVIKYMYGNMHIPFDFNGFEGNIIANFLFANNGANIEEIEIEDIIERLDILVLQNPEIEGMDVIEPYIFNKRFTV |
| 1 |
Diverse begomovirus-betasatellite complexes cause tomato leaf curl disease in the western India. Sangeeta, et al. Virus Res. 2023 Apr 15;328:199079. doi: 10.1016/j.virusres.2023.199079. Epub 2023 Mar 3. PMID: 36813240 |
|---|---|
| 2 |
Sangeeta, et al. Virus Res. 2021 Apr 2;295:198319. doi: 10.1016/j.virusres.2021.198319. Epub 2021 Jan 26. PMID: 33508355 |
| 3 |
Vo TTB, et al. Microorganisms. 2023 Dec 1;11(12):2907. doi: 10.3390/microorganisms11122907. PMID: 38138051 |
| 4 |
Genetic variability of Cotton leaf curl betasatellite in Northern India. Sohrab SS, et al. Saudi J Biol Sci. 2014 Dec;21(6):626-31. doi: 10.1016/j.sjbs.2014.11.006. Epub 2014 Nov 13. PMID: 25473373 |
| 5 |
Differential pathogenicity among Tomato leaf curl Gujarat virus isolates from India. Ranjan P, et al. Virus Genes. 2013 Dec;47(3):524-31. doi: 10.1007/s11262-013-0977-0. Epub 2013 Sep 12. PMID: 24026875 |
| 6 |
Rathore S, et al. Plant Dis. 2014 Mar;98(3):428. doi: 10.1094/PDIS-07-13-0719-PDN. PMID: 30708408 |
| 7 |
Tomato Leaf Curl New Delhi Virus: An Emerging Virus Complex Threatening Vegetable and Fiber Crops. Moriones E, et al. Viruses. 2017 Sep 21;9(10):264. doi: 10.3390/v9100264. PMID: 28934148 |
| 8 |
Dokka N, et al. Virus Res. 2021 Oct 2;303:198521. doi: 10.1016/j.virusres.2021.198521. Epub 2021 Jul 24. PMID: 34314770 |
| 9 |
A New Begomovirus Species Causing Tomato Leaf Curl Disease in Patna, India. Kumari P, et al. Plant Dis. 2009 May;93(5):545. doi: 10.1094/PDIS-93-5-0545B. PMID: 30764166 |
| 10 |
Khan ZA, et al. Arch Virol. 2017 Feb;162(2):561-565. doi: 10.1007/s00705-016-3096-0. Epub 2016 Oct 13. PMID: 27738844 |