| Abbreviation | ToLCuB2 |
|---|---|
| Genebank Accession | KU500806 |
| Isolate | IN-CN4B-15 |
| Download | Genome |GFF3 |PEP |CDS |
| NCBI Accession | ANV28028.1 |
|---|---|
| Location | 205-561 |
| Gene Name | BC1 |
| Protein Name | betaC1 protein |
| Coding Region | ATGACGATCAAATATAATAACAAGAGGGGGATGGAGTTTACCATCGACGTAAAATCAAAGAAGGACAATTCAATCCTAGTACAGATTGAATTGTTCTCAACAAAATCACCAACCCTGGCAAGAAGACCATTCATGATCCCATACGGCCATGATGGGATCATACCTCCGTTCGACTTCAACGCTCTAGAGGAAGGTATACGAGTCATGAAAGATCTAATGTACAAGAATTCTGATATAAAAGAGTTCGAGCAAGAGGATATGGTGGAGACAATTGATTTACTCATGATGGAAGAGGCTCCATTAGTTGATATTTACGTAAGGGATGAATACGATGTATGTACGAACTCATCTGTTTAA |
| Protein Sequence | MTIKYNNKRGMEFTIDVKSKKDNSILVQIELFSTKSPTLARRPFMIPYGHDGIIPPFDFNALEEGIRVMKDLMYKNSDIKEFEQEDMVETIDLLMMEEAPLVDIYVRDEYDVCTNSSV |
| 1 |
First Report of Tomato yellow leaf curl China virus with Betasatellite Infecting Panax notoginseng. Li XJ, et al. Plant Dis. 2014 Sep;98(9):1284. doi: 10.1094/PDIS-03-14-0255-PDN. PMID: 30699620 |
|---|---|
| 2 |
The Global Dimension of Tomato Yellow Leaf Curl Disease: Current Status and Breeding Perspectives. Yan Z, et al. Microorganisms. 2021 Apr 1;9(4):740. doi: 10.3390/microorganisms9040740. PMID: 33916319 |
| 3 |
Ammara UE, et al. Plant Dis. 2015 Mar;99(3):421. doi: 10.1094/PDIS-09-14-0912-PDN. PMID: 30699712 |
| 4 |
Genetic variability of Cotton leaf curl betasatellite in Northern India. Sohrab SS, et al. Saudi J Biol Sci. 2014 Dec;21(6):626-31. doi: 10.1016/j.sjbs.2014.11.006. Epub 2014 Nov 13. PMID: 25473373 |
| 5 |
Wang Y, et al. Virology. 2023 Sep;586:1-11. doi: 10.1016/j.virol.2023.07.003. Epub 2023 Jul 14. PMID: 37473501 |
| 6 |
Rathore S, et al. Plant Dis. 2014 Mar;98(3):428. doi: 10.1094/PDIS-07-13-0719-PDN. PMID: 30708408 |
| 7 |
Kharazmi S, et al. Mol Biotechnol. 2016 May;58(5):362-72. doi: 10.1007/s12033-016-9935-0. PMID: 27041273 |
| 8 |
Sohrab SS, et al. Virusdisease. 2016 Jun;27(2):145-53. doi: 10.1007/s13337-016-0308-x. Epub 2016 Mar 4. PMID: 27366765 |
| 9 |
Sharma P, et al. Arch Virol. 2011 Feb;156(2):305-12. doi: 10.1007/s00705-010-0837-3. Epub 2010 Oct 30. PMID: 21053032 |
| 10 |
Venkataravanappa V, et al. Iran J Biotechnol. 2019 Jan 11;17(1):e2134. doi: 10.21859/ijb.2134. eCollection 2019 Jan. PMID: 31457044 |