| Abbreviation | ToLCB |
|---|---|
| Genebank Accession | AJ316036 |
| Isolate | PK-RYK-97 |
| Download | Genome |GFF3 |PEP |CDS |
| NCBI Accession | CAC87062.1 |
|---|---|
| Location | 201-557 |
| Gene Name | C1 |
| Protein Name | putative C1 protein |
| Coding Region | ATGACGATCAAATATAATAACAAAAGGGGGATGGAGTTTACCATCGACGTGAAAATCAACGAGGACAATTCAATCCTAGTACAGATTGAATTGTTCTCAACACAATCACCAGCCCTGGCAAAGAAGACCTTCATGATCCCATACGGCCATGATGGGATCATACTTCCGTTCGACTTCAACGCTCTAGAGGAAGGTATACAAAATCTGTTGCAAATCATGTACAAGGATTCTGATATAGGAGAGTTTCGACAAGAGGATATGGTGGAGACAATTGATTTACTCATGATGGAAGAAGCTCCATTACTTGATATACGTATAAGAGATGAATACGATGTATGTACGAATGTGTGTGTGTGA |
| Protein Sequence | MTIKYNNKRGMEFTIDVKINEDNSILVQIELFSTQSPALAKKTFMIPYGHDGIILPFDFNALEEGIQNLLQIMYKDSDIGEFRQEDMVETIDLLMMEEAPLLDIRIRDEYDVCTNVCV |
| 1 |
Diverse begomovirus-betasatellite complexes cause tomato leaf curl disease in the western India. Sangeeta, et al. Virus Res. 2023 Apr 15;328:199079. doi: 10.1016/j.virusres.2023.199079. Epub 2023 Mar 3. PMID: 36813240 |
|---|---|
| 2 |
Al-Matroushi AR, et al. Cell Mol Biol (Noisy-le-grand). 2024 Nov 27;70(11):101-108. doi: 10.14715/cmb/2024.70.11.15. PMID: 39707774 |
| 3 |
Tomato Leaf Curl New Delhi Virus: An Emerging Virus Complex Threatening Vegetable and Fiber Crops. Moriones E, et al. Viruses. 2017 Sep 21;9(10):264. doi: 10.3390/v9100264. PMID: 28934148 |
| 4 |
The Global Dimension of Tomato Yellow Leaf Curl Disease: Current Status and Breeding Perspectives. Yan Z, et al. Microorganisms. 2021 Apr 1;9(4):740. doi: 10.3390/microorganisms9040740. PMID: 33916319 |
| 5 |
Sangeeta, et al. Virus Res. 2021 Apr 2;295:198319. doi: 10.1016/j.virusres.2021.198319. Epub 2021 Jan 26. PMID: 33508355 |
| 6 |
Zaidi SS, et al. Mol Plant Pathol. 2017 Sep;18(7):901-911. doi: 10.1111/mpp.12481. Epub 2016 Oct 17. PMID: 27553982 |
| 7 |
Xie Y, et al. Virology. 2024 Jun;594:110040. doi: 10.1016/j.virol.2024.110040. Epub 2024 Mar 5. PMID: 38471198 |
| 8 |
Vo TTB, et al. Microorganisms. 2023 Dec 1;11(12):2907. doi: 10.3390/microorganisms11122907. PMID: 38138051 |
| 9 |
Li Z, et al. Mol Plant Pathol. 2025 Jan;26(1):e70051. doi: 10.1111/mpp.70051. PMID: 39810290 |
| 10 |
Differential pathogenicity among Tomato leaf curl Gujarat virus isolates from India. Ranjan P, et al. Virus Genes. 2013 Dec;47(3):524-31. doi: 10.1007/s11262-013-0977-0. Epub 2013 Sep 12. PMID: 24026875 |