Tobacco curly shoot betasatellite


Basic Information

Abbreviation TobCSB
Genebank Accession AJ421484
Isolate CN-Yn35-01
Download Genome |GFF3 |PEP |CDS

Genome

ACCGGTGGCGAGCGGGGTCTTTGGTGCTGATGGTGGGCCCCACATATGAAATTGGGCCTTAAATGGGCCAAAAAAGATTACTGGGTATGCAATTTGGTCTCTTGTTGGGCTCTTTCAATTTGGGTCTACACAGTACTACGTTGATAATATAAATATTTATTTTATTATTTAATACTTATGTTATGCATTACATACGGATTAAAATACGTATTCATACATTAGCTATTGTCCCTATATCATAATCTTCCTCTACGTCTATATCCTCAACAGCCGCTTCTTGCATCATCAGGATATCAATCGTCTGGACCATGTCCTCCTGTTTGAAATCTCGTATTGTGGATTCGTTGTACATTATACGTAATAAATTACGTATTCCTTCCTCTAAGTTATTGAAATTGAATGGTGGTATGATCCCACTATGTCCGTATGGGATGATGTATTTCCTCTTTGCCAGTGCTGGTGATTTTGTTGATATCAATTCAATCTGAACAACGATTGAATTGTCCTCCTTCAACTTAACATCAACGATGAACTCCATGCCCTTCTTGTTGTTGTATTTAATTGTCATATTTGTTCTTGTGACCAAAACGTTAGTTCTGTCCCTTTAAATAATCATTTTCATATGCTATTCATGGTCTGAAATGATTTACGTGTTTCTTGCTTGTTCATATGTTTGGTAGTGGAGATCTTTGTATCGGATGTGACGCTGTTGTTAATGGTGTGGTTAATGTGTAATTAGAATTAAATGTGTAGTTAGACGTTAGTACTAATCATAACATGATTAGGAAAGGAAAAAAGAAAAAAGAAAAAAACTGAAATTAAATACAATAAAACTCATAACATCCATTATCCTAAAATGGGAGCGCAGCGAAACGAAAACCCCAATGACGAACAAGAAAACAAGAAAAAAAAATAAAAACAAAAGAAAAACTCATACACTCAGAACAATAAACCTTGAAGAAATTTCAGTGGACCCCACCTAATTAAAAGAATAAATAAAAAGAATAAAATGATTTACTGCACGGTAAATCAGTAATTAATAATTACTGAGGTGAATGGGTAAAAACATGAGGACCTGATAGGTAAATGAGGACCCGATACATCGGGGACTCAATTGGGGACTATTAATTTACTTTCCCAAAATACCCTTGTCCCTGTGTCTGGTAGGCGCGTGAGAGTGGACTGAAAAAGTAGAGTTTCTCTCTCCTAAAACTCCTCCGACCGCCGATTCAGGCACTTCCGTTCACCAATTTGCGACACGCGCGGCGTTGTGTACCCCTGGGAGGGTAGAAACCACTACGCTACGCAGCAGCCTTAGCTACGCCGGAGCTTAGCTCGCCACCGTTATAATATT

Gene Information

NCBI Accession CAD13345.1
Location 212-568
Gene Name C1
Protein Name putative C1 protein
Coding Region ATGACAATTAAATACAACAACAAGAAGGGCATGGAGTTCATCGTTGATGTTAAGTTGAAGGAGGACAATTCAATCGTTGTTCAGATTGAATTGATATCAACAAAATCACCAGCACTGGCAAAGAGGAAATACATCATCCCATACGGACATAGTGGGATCATACCACCATTCAATTTCAATAACTTAGAGGAAGGAATACGTAATTTATTACGTATAATGTACAACGAATCCACAATACGAGATTTCAAACAGGAGGACATGGTCCAGACGATTGATATCCTGATGATGCAAGAAGCGGCTGTTGAGGATATAGACGTAGAGGAAGATTATGATATAGGGACAATAGCTAATGTATGA
Protein Sequence MTIKYNNKKGMEFIVDVKLKEDNSIVVQIELISTKSPALAKRKYIIPYGHSGIIPPFNFNNLEEGIRNLLRIMYNESTIRDFKQEDMVQTIDILMMQEAAVEDIDVEEDYDIGTIANV

References More References in PubMed

1

Suppression of nbe-miR1919c-5p Expression in Nicotiana benthamiana Enhances Tobacco Curly Shoot Virus and Its Betasatellite Co-Infection.

Du J, et al.  Viruses. 2020 Apr 1;12(4):392. doi: 10.3390/v12040392.

PMID: 32244650

2

Identification of microRNAs regulated by tobacco curly shoot virus co-infection with its betasatellite in Nicotiana benthamiana.

Du J, et al.  Virol J. 2019 Nov 7;16(1):130. doi: 10.1186/s12985-019-1234-5.

PMID: 31699111

3

Transcriptome analysis of Nicotiana benthamiana infected by Tobacco curly shoot virus.

Li K, et al.  Virol J. 2018 Sep 3;15(1):138. doi: 10.1186/s12985-018-1044-1.

PMID: 30176884

4

Characterization of Pathogenicity-Associated V2 Protein of Tobacco Curly Shoot Virus.

Li M, et al.  Int J Mol Sci. 2021 Jan 18;22(2):923. doi: 10.3390/ijms22020923.

PMID: 33477652

5

A recombinant Tobacco curly shoot virus causes leaf curl disease in tomato in a north-eastern state of India and has potentiality to trans-replicate a non-cognate betasatellite.

Shilpi S, et al.  Virus Genes. 2015 Feb;50(1):87-96. doi: 10.1007/s11262-014-1141-1. Epub 2014 Nov 20.

PMID: 25410052

6

First Report of Tobacco curly shoot virus Infecting Pepper in China.

Qing L, et al.  Plant Dis. 2010 May;94(5):637. doi: 10.1094/PDIS-94-5-0637A.

PMID: 30754455

7

Iterons Homologous to Helper Geminiviruses Are Essential for Efficient Replication of Betasatellites.

Xu X, et al.  J Virol. 2019 Feb 19;93(5):e01532-18. doi: 10.1128/JVI.01532-18. Print 2019 Mar 1.

PMID: 30541843

8

Cryo-EM Structure of a Begomovirus Geminate Particle.

Xu X, et al.  Int J Mol Sci. 2019 Apr 8;20(7):1738. doi: 10.3390/ijms20071738.

PMID: 30965627

9

Characterization of alphasatellites associated with monopartite begomovirus/betasatellite complexes in Yunnan, China.

Xie Y, et al.  Virol J. 2010 Aug 3;7:178. doi: 10.1186/1743-422X-7-178.

PMID: 20678232

10

Temporal Dynamic of the Ratio between Monopartite Begomoviruses and Their Associated Betasatellites in Plants, and Its Modulation by the Viral Gene βC1.

Wu YJ, et al.  Viruses. 2023 Apr 13;15(4):954. doi: 10.3390/v15040954.

PMID: 37112934