Cotton leaf curl Bangalore betasatellite 1


Basic Information

Abbreviation CLCuBaB1
Genebank Accession AY705381
Isolate IN-05
Download Genome |GFF3 |PEP |CDS

Genome

ACCGTGGGCGAGCGGTGCCTCTGGCGAACGCAGTGGGTCCCACTGCTTGTTTGGACTGGATTTGACTTGTATTGGGCCAAGTTAATGGGCTTGGAAGTGTTTGGGCCTTTGAAATTGGCCTTTTATGTGGTTTAGGGCTCTGTCTGTTGTAAGTGATATGTGTGTAATTATGCCTTGCTGGTCTGTGTTTGGAATTTAAACGGTGAATGTTTTATTGAATACGTACGGTTCGATTACATTTATTCCTAGAATATCTGGGTTTTCTAGTACAAGTATATCAAGCCTTTGAATTATGTCTTCTATCTCGATCTCATCTATTTTTGCCCCGTTGTTTGCGAATAGGAAATTCGCTATGATGTTCCCTTCAAAGCCGTTGAAGTCGAATGGAACGTGCATGTCTCCGTACGTGTACTTGACGATCCCTTCATACTTGATGATCGCTGATGACTTGGTGGATACCAACCTCATGTGAATGAATATCTTCATGTCCTCCATGATGCGTACGTCGACTGTGAACCTGACTCCCTGCTTGGTTGTCCCGCTCCTTGTCATTTTTGCTTATTGGATGGAATTGGTTATTATGGCTGTGTTTATAGATCCAATGATGAGATATTTTGTGTTGTTATGTGGTTGTTAGTGATCCTTGATCATGTGATTGTGGATTAAAGGGTTAAAGATATGATGGAGATGTACTTCATGTGTTTGATGTTGGTTTGAGACTTCTATACATGGGTTTGTACCGTATATGCCTCTATATACGGATAGGAGTAGAAAAAGGATAAGAAAAAGAGAAAACTGAACTGAAGAGGAAAGAAAAAAGAAAATAAGGAAAGAACTACTAATCAAAAAAAGAAATGGGAGCGCAGCGACCCGAAACAGGAAACCCGAGGAAAGAGAAAAAATAAAAAGAAACAAAAAAATAAAAACTCGAAAACGTCATCGTTTGAGAGGAGATAAAAAAAAGAAAAAACTAAAATAGAACCGAGAACGACATCGTTCGAAGGTGACTGAGGTGTTTTACCATTTACTGGGCGGTAAATGGTAAATGGGTAAAAAGAGGTAAAAAATATTGAGTACCAATAGGTAAATTGAGTACCGATATATCGGTACTCAATTAGAGTCTCATTTTATACCTTTCCGTAAATACCCCCGCTTTTATGTCTAATAGGCGCGTCGGAGTGCGCTGATAAAGTGAACCTTCTCTCTCCGTTTTGGGACTCTAATACAATTTCCCGGTTATCGGCGGCGAATTTTTCGACACGCGCGGCGGTGTGTACCCCTGGGAGGGTAGGTACCACTACGCTACGCAGCAGCCTTAGCTACGCCGGAGCTTAGCTCGCCCACGTTCTAATATT

Gene Information

NCBI Accession AAW28995.1
Location 196-552
Gene Name C1
Protein Name C1 protein
Coding Region ATGACAAGGAGCGGGACAACCAAGCAGGGAGTCAGGTTCACAGTCGACGTACGCATCATGGAGGACATGAAGATATTCATTCACATGAGGTTGGTATCCACCAAGTCATCAGCGATCATCAAGTATGAAGGGATCGTCAAGTACACGTACGGAGACATGCACGTTCCATTCGACTTCAACGGCTTTGAAGGGAACATCATAGCGAATTTCCTATTCGCAAACAACGGGGCAAAAATAGATGAGATCGAGATAGAAGACATAATTCAAAGGCTTGATATACTTGTACTAGAAAACCCAGATATTCTAGGAATAAATGTAATCGAACCGTACGTATTCAATAAAACATTCACCGTTTAA
Protein Sequence MTRSGTTKQGVRFTVDVRIMEDMKIFIHMRLVSTKSSAIIKYEGIVKYTYGDMHVPFDFNGFEGNIIANFLFANNGAKIDEIEIEDIIQRLDILVLENPDILGINVIEPYVFNKTFTV

References More References in PubMed

1

Association of a recombinant Cotton leaf curl Bangalore virus with yellow vein and leaf curl disease of okra in India.

Venkataravanappa V, et al.  Indian J Virol. 2013 Sep;24(2):188-98. doi: 10.1007/s13337-013-0141-4. Epub 2013 Jul 16.

PMID: 24426275

2

Molecular characterization of novel bipartite begomovirus associated with enation leaf disease of Garden croton (Codiaeum variegatum L.).

Venkataravanappa V, et al.  Virusdisease. 2022 Jun;33(2):194-207. doi: 10.1007/s13337-022-00772-0. Epub 2022 Jul 1.

PMID: 35991698

3

Suppressors of RNA silencing encoded by tomato leaf curl betasatellites.

Shukla R, et al.  J Biosci. 2013 Mar;38(1):45-51. doi: 10.1007/s12038-012-9291-6.

PMID: 23385812