Dolichos yellow mosaic virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_001343705.1
Isolate India
Release date 2015/10/17
Submitter Akram,M., Naimuddin, Agnihotri,A.K., Gupta,S.
Host
Vector
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_024779
ACCGGATGGCCGCCCGGTGTCTTTGGTGTCGTGGGCCCCACACGTACGAACTGCTGTCGTGGCGCACTCTCGTTGCGTCCTGGAGGCTATTTTACGCACTCAACGCGGTCCCCACTAAATTCAATTCAAAGTGCGCCTTTGAATTGTCCATTTTGCCCTTCTCATCTTTTCCCATATCAAAGGCACCATTCGTGAGATAGGGGTATCGAACGTCCATCTAAAAACTATGACCGATATGACCGGTAGCCCTTTCCCACAACATGCAACGCCCATTTCTTCTTTAAATACCCGTTCTTAATAAGAACGGTCGTTCATATGTCATATCGGCATGTATCGCTCACGATCAACTCCCCTATCTGCTCGACGACCTCTGGTCAACCCGTTCGTCCGAGAACGGCAATTTGTTCCTCGTCGAACACCACGTTTTTTCAGAAAACGAGTTCATGCGACTCATCGTACGAGTCGCCGCCTATCTTACGAAAGAGTTGATCGTCCTATGTCCTTCAATGTCGTCGTTGAACGCCAACATGGTGATCATATGGCCCTGGTGAATAACCAGGACATTACATCTTTTATTGGCTATCCTATTCGTGGGTTCAACGAGGGACGATGCAGAGACTATATCAAGCTTCTGACACTCAATGTGTCAGGTATGATAACAGTCCGTTCGTTATCGACTGACGCCCCTATGTCCAGTAATGGCATCGTCAACGGAACCTTTGTTCTCTCGTTCGTATTGGACAAGAAGCCATATCTCCCTGATGGCGTTAACACGCTGCCCTCATTTGCGGAGCTATTTGGTCCATTCTCAGCGGCGTATTTCAACTTACGCCTGCTGGATTCTCAAAGAGAGAGGTTCAGATTATTGGGCAGCGTAAAGAAACATGTGTCATGTGGCGCTGATGAAGTAGAAGTCCCGTTCAAGTTCAAGAGGACCTTGTCGACAACAAGGTCTACTATGTGGGCCACGTTCAAGGACGTGGATATGGGCAATAGTGGAGGAAATTATAGAAATATCAGCAAGAACGCCATTTTAGTTAGTTATGCATTCGTTTCAATGCATAACATAAAGTGTGAACCATATGTACAATACGAACTGTCATATTTTGGTTAATAAAATCTCATTTTATTACATATCTTATTTATATCGTTGCTACACAATCACAACGCTTTACTGACATCAGTGCGTTGTTTTATCAAACATTTATTAACTGTCGACTCTACTATGTTCTCTATATCTGCCTTGGACAAATTCATCGAATTTGTTTGCGAAATTGAATCTCCGGGGTCTAATGATGTCTCGGGTAATTTGTGCAAGTGTCTAAGAGGAAACTCCGCGTCTGAATAAGTGTTCAGGCCCAATTCAGACTTTGGGCCTGATGTCGTATCCACGTCATATCGCATAGATGCGGATCTGCCAATCGTGGACCGCGTTGCCCAAGTCTCTCCTGGCATTAATTTGATCTGGTGGGCTCTTGGCCCATTAACAGCTGCGGGCTGGAGAAGCCTCCGAACAGCTTTGGGTTTGTCCACTGACCAGAAATCTACACAATCCTTTGTGTAGTTCTTTGACAGAATGTTAATCGTCGGAGGCTTGAAGGTTATGTCTGTGGAGTGTTTGGCTGACGACAATTTCAGCTTCGCCTTAATCTGTGCGAATGTCGTTCCGTCGACCACATTTGAGTCTTCCACTCTATACAAAAGCTCCCAGGGAGTCTCGTCCTTCAAGGAGAAGAAGGAGGAGGAAAAATAATGTAGGTCGACGTTGCAGCCTATGGGAAAGGTAAAAGCCGCCTGTGACGCCTCGTCGTCACTCAACCTGTTATCGCGTATGGTGACGATAACCGACCCCTTCGCATTAAAAGGCACCTGATTCCTGTATTCGATCACTATATGATCGACCTTCATGCACTTTCCCATCATTCGCACCTTTGTCTGCTCAAACGATGAAGGAAACTGAAGAGTGATCGGTGTCTCATTATTCGTCAGCCGATATTCACAGCGCTTGGACTCTATATAGCGGTTGTTCACGACCGCGCCGTTGAATGCTTCCATTTCAGAAAATATGCGAGAATCGCCCCTATGCTGTGAATCCTGTTAAATGCATCACAATCGAAAACAGAATGAGTAATAACTATTACGAATCTATCTAAGAACACGCATATTCACTAATCTGCCCTAATCGATGCATTTCTTTAACCTAGGCCGCGCAGCGGAAACCCTAGATTGTTCGATTGCCCTCTTTCATATGAACAATCCATCTAATTAAAAGCTAAGAACGATCATAATCCATGTCAACATAAGCAAAGAAAGACCATAAAGAAGAATTAAAGAAGATTGCTCGCCAATCTTCTGTAGCTTATTACCAAATCTCCACTGAACTGATGCGGTAGCTGTTCATGCCATGCCCTATTTATAGAAAGTAAAGCAAATTCATACATTTGCGTCTCATGGTCTTAATTATGAAAATAAAGAAGTTTATTTTCTAAAATGCCCTTGCTGACTTGGTGTGCTCAGCACGACATTCATATGAAGCTACTGTGAAGAAATCGTTTTGACAAAACGCGGAAACGAAACGACACAGAAAGCTCGCGTTTTGCTATGCAGTGCCACGTCATCGGTGTATCGGTGTCGCTTCAAAGTTCCCAGAATTGGTGTCATTGGTGTCGCATATATAGGTACCCCTAATATATGCTATATGCGCATTTGGTTGCGGCCATCCGCTATAATATT

NC_005338
ACCGGATGGCCGCCCGCCCGCCACGTGTCTCAATCCTGGCGCTCCGTGGAGTCTTATTTAGCGCTCCCGGATTTCAAATTTCACTATAAAACTTGGTCGACAAGTTTTACACATCAATCTAAATGTGGGTCCCATTAGTCAATGACTTTCCTGACACACTGCATGGATTGCGGTGTATGTTAGCTGTGAAATTTGTGCAGGAATTATTGGAGAGCTATCCGCGTGACTCTAATGGGCGCATCCTATTGGAGGAACTAATCCGGGTGTTGCGTTGTAAACGTTATGCCAAAGCGCAATTTCGATATGGCGTTTTCTACTCCAAGACCCAGCGTACGGCGAAGGCTCAACTTCGACACCCCATCTGCAACACCGATGTCAGTTCGTCGAACTCCGAGCACCAGTCGTCGTAGAGCATGGACCAATCGTCCAATGAATCGCAAACCGCGCATATATCGTCTATATCGCTCACGCGATGTACCATATGGGTGCGAGGGACCATGTAAAGTTCAATCCTTTGAACAACGGCATGATATCAGTCATACTGGTAAGGTCCTGTGTGTTTCCGATGTCACTAGAGGAAACAACCTTACTCATCGTGTTGGTAAACGATTTTGTGTTAAATCTGTTTACATTATTGGCAAAATTTGGATGGACGAGAACATTAAGACAAAGAACCATACAAACACAGTCATGTTTTGGCTAGTTCGTGATCGACGACCTTTTGGAACCCCAATGGACTTAGGGCAAGTGTTCAACATGTATGATAATGAACCCTCGACCGCCACTATCAAAAACGATCTTCGTGATCGTTACCAAGTTTTACGTAAGTTCGATTCAACTGTCACCGGAGGTCAATATGCGTCGAGGGAAGCAAATGTTATCAAGAGATTTTGGCGTGTCAACAATTATGTGGTGTACAACCACCAAGAAGCTGCTAAGTATGAAAATCATACTGAAAATGCATTATTATTGTATATGGCATGTACTCATGCCTCAAACCCAGTGTATGCAACATTAAAGATCAGGATCTATTTCTATGATTCTATCTCAAATTAATAAAATCTCATTTTTATTAATATAACTTCCATTGTACATTAAATTCGAAATCAACAGCTTCGACTCGCTGAAATACATCATACAATACATATTCGCAACTGCGTAATACATTGTTCATCGAAATAATTCCTAAATTATTTAAAAATCTAAAAAGGAAGTTCCTGAATACATTCAAGATCCGCCCAGATTGCGGAGTCAATCGATGGTAAATCACTAAATCCAAGAATGCCTTGTGTATCCCCAACGCTTTCTTCAACCCGTGGTTGAACATTATGCGGATCTTGGTTCTGTGTTGGTTCGGATCGAACATGAATCCCTCGTGATGCTCCAGGATCTTGAAAGACAGGGGATTCTTTAGCTCCCAGATAAACACGCCACTCTGTAGTTGAGCTGCAGTGATGGATTCCCCTGTGCGTGAATCCGTCATTCCGGCAGTTGATATTCAGGTAATACGAACAGCCACAGGTCAGATCGATTCGCTTACGCCGAATCGTTTTGCGCTTCTTCGCTTGTCGATGCTGTGCCTTGATGCTCGGTAGAGAACAATGGCTGTTCGAGGGTGATGAAGACCGCATTCTTGTAAGCCCACTCCTTCAATGATTCGTTCTGTTCCTCATCAAGGAACTCTTTATAGGACGAACGTGGTCCTGGATTGCAAAGAAAGATGGTGGGTATCCCACCTTTAATTTGAGTGGGCTTACCGTATTTGATGTTGCTTTGCCAGTCCATCTGGGCCCCCATAAACTCTTTAAAATGCTTTAGATAATGCGGATCAACGTCATCAATGACGTTATACCAAGCATCATTTGAAAATATCTTAGGGCTAAGATCCAGGTGTCCACACATGTAATTATGGACTCCTAATGACCGTGCCCATAACGTCTTCCCTGTTCTTGTTGCTCCTTCAACAACGATGCTCATCGGTCTTCTCGGCCGCGCAGCGGGGTCGCTCCTCCACGAAGGATCAACAACGTTATTTTCTGCCCATTCTGTCATAACAGACGGCACTTGACTAAAGTCGGCAGGCTTGTAATATGACGTGTAAACTGCAATCGGAGGAGCGAATATTCGTTCAAGGTTACATCTCAGATTATGATACTGGAACACATAATTGTGTGGAAGTAATTCTTTGATAATGTTCAGAGCACCTTGAACCGTACCGGAATTCAACGCCGATGCTACAGCATCGTCAGCTGTCTGACGACCTCCTCTAGCAGATCGTCCGTCGATCTGAAATGTTCCCCAGTCGACGTAATCACCGTCCTTGGTGATGTAGGATTTGACATCAGATGAGCTCTTTGCTCCCTGGACATTTCCATGGAAAACCTGTGTGCTATGAGGATGGGTAAGGTCGAAATGTCTTGCATTTCGGAACTGGGCCTTACCCTTGAACTGGACGAGGGCATGGAGATGCATAGTCCCATCTTGATGTGCTTCTTGTGCCACTCTGATGAACAATTTGTCCGACGGACACTCGATGCGACAGAGCTGCTCGAGAGCTTCTTCCTTTGAGAGAGAGCATTTGGGGTAGGTCAGAAATATATTTCTGGCAGATATGCGGAAGCCTGGAGCTCTCATTTTTTAAATGAGACTAATGCCACGTCATCGGTGTATCGGTGTCGCTTCAAAGTTCCCAGAATTGGTGTCTTTGGTGTCGCATATATAGGGGTCTCTAATAAGGGGTACGGCCATCCGCAATAATATT

Gene Information

NCBI Accession YP_009055065.1
Location 329-1114
Protein Name BV1
Coding Region ATGTATCGCTCACGATCAACTCCCCTATCTGCTCGACGACCTCTGGTCAACCCGTTCGTCCGAGAACGGCAATTTGTTCCTCGTCGAACACCACGTTTTTTCAGAAAACGAGTTCATGCGACTCATCGTACGAGTCGCCGCCTATCTTACGAAAGAGTTGATCGTCCTATGTCCTTCAATGTCGTCGTTGAACGCCAACATGGTGATCATATGGCCCTGGTGAATAACCAGGACATTACATCTTTTATTGGCTATCCTATTCGTGGGTTCAACGAGGGACGATGCAGAGACTATATCAAGCTTCTGACACTCAATGTGTCAGGTATGATAACAGTCCGTTCGTTATCGACTGACGCCCCTATGTCCAGTAATGGCATCGTCAACGGAACCTTTGTTCTCTCGTTCGTATTGGACAAGAAGCCATATCTCCCTGATGGCGTTAACACGCTGCCCTCATTTGCGGAGCTATTTGGTCCATTCTCAGCGGCGTATTTCAACTTACGCCTGCTGGATTCTCAAAGAGAGAGGTTCAGATTATTGGGCAGCGTAAAGAAACATGTGTCATGTGGCGCTGATGAAGTAGAAGTCCCGTTCAAGTTCAAGAGGACCTTGTCGACAACAAGGTCTACTATGTGGGCCACGTTCAAGGACGTGGATATGGGCAATAGTGGAGGAAATTATAGAAATATCAGCAAGAACGCCATTTTAGTTAGTTATGCATTCGTTTCAATGCATAACATAAAGTGTGAACCATATGTACAATACGAACTGTCATATTTTGGTTAA
Protein Sequence MYRSRSTPLSARRPLVNPFVRERQFVPRRTPRFFRKRVHATHRTSRRLSYERVDRPMSFNVVVERQHGDHMALVNNQDITSFIGYPIRGFNEGRCRDYIKLLTLNVSGMITVRSLSTDAPMSSNGIVNGTFVLSFVLDKKPYLPDGVNTLPSFAELFGPFSAAYFNLRLLDSQRERFRLLGSVKKHVSCGADEVEVPFKFKRTLSTTRSTMWATFKDVDMGNSGGNYRNISKNAILVSYAFVSMHNIKCEPYVQYELSYFG

NCBI Accession YP_009055066.1
Location 1162-2055
Protein Name BC1
Coding Region ATGGAAGCATTCAACGGCGCGGTCGTGAACAACCGCTATATAGAGTCCAAGCGCTGTGAATATCGGCTGACGAATAATGAGACACCGATCACTCTTCAGTTTCCTTCATCGTTTGAGCAGACAAAGGTGCGAATGATGGGAAAGTGCATGAAGGTCGATCATATAGTGATCGAATACAGGAATCAGGTGCCTTTTAATGCGAAGGGGTCGGTTATCGTCACCATACGCGATAACAGGTTGAGTGACGACGAGGCGTCACAGGCGGCTTTTACCTTTCCCATAGGCTGCAACGTCGACCTACATTATTTTTCCTCCTCCTTCTTCTCCTTGAAGGACGAGACTCCCTGGGAGCTTTTGTATAGAGTGGAAGACTCAAATGTGGTCGACGGAACGACATTCGCACAGATTAAGGCGAAGCTGAAATTGTCGTCAGCCAAACACTCCACAGACATAACCTTCAAGCCTCCGACGATTAACATTCTGTCAAAGAACTACACAAAGGATTGTGTAGATTTCTGGTCAGTGGACAAACCCAAAGCTGTTCGGAGGCTTCTCCAGCCCGCAGCTGTTAATGGGCCAAGAGCCCACCAGATCAAATTAATGCCAGGAGAGACTTGGGCAACGCGGTCCACGATTGGCAGATCCGCATCTATGCGATATGACGTGGATACGACATCAGGCCCAAAGTCTGAATTGGGCCTGAACACTTATTCAGACGCGGAGTTTCCTCTTAGACACTTGCACAAATTACCCGAGACATCATTAGACCCCGGAGATTCAATTTCGCAAACAAATTCGATGAATTTGTCCAAGGCAGATATAGAGAACATAGTAGAGTCGACAGTTAATAAATGTTTGATAAAACAACGCACTGATGTCAGTAAAGCGTTGTGA
Protein Sequence MEAFNGAVVNNRYIESKRCEYRLTNNETPITLQFPSSFEQTKVRMMGKCMKVDHIVIEYRNQVPFNAKGSVIVTIRDNRLSDDEASQAAFTFPIGCNVDLHYFSSSFFSLKDETPWELLYRVEDSNVVDGTTFAQIKAKLKLSSAKHSTDITFKPPTINILSKNYTKDCVDFWSVDKPKAVRRLLQPAAVNGPRAHQIKLMPGETWATRSTIGRSASMRYDVDTTSGPKSELGLNTYSDAEFPLRHLHKLPETSLDPGDSISQTNSMNLSKADIENIVESTVNKCLIKQRTDVSKAL

NCBI Accession YP_009029988.1
Location 123-410
Protein Name AV2
Coding Region ATGTGGGTCCCATTAGTCAATGACTTTCCTGACACACTGCATGGATTGCGGTGTATGTTAGCTGTGAAATTTGTGCAGGAATTATTGGAGAGCTATCCGCGTGACTCTAATGGGCGCATCCTATTGGAGGAACTAATCCGGGTGTTGCGTTGTAAACGTTATGCCAAAGCGCAATTTCGATATGGCGTTTTCTACTCCAAGACCCAGCGTACGGCGAAGGCTCAACTTCGACACCCCATCTGCAACACCGATGTCAGTTCGTCGAACTCCGAGCACCAGTCGTCGTAG
Protein Sequence MWVPLVNDFPDTLHGLRCMLAVKFVQELLESYPRDSNGRILLEELIRVLRCKRYAKAQFRYGVFYSKTQRTAKAQLRHPICNTDVSSSNSEHQSS

NCBI Accession YP_009029989.1
Location 283-1056
Protein Name AV1
Coding Region ATGCCAAAGCGCAATTTCGATATGGCGTTTTCTACTCCAAGACCCAGCGTACGGCGAAGGCTCAACTTCGACACCCCATCTGCAACACCGATGTCAGTTCGTCGAACTCCGAGCACCAGTCGTCGTAGAGCATGGACCAATCGTCCAATGAATCGCAAACCGCGCATATATCGTCTATATCGCTCACGCGATGTACCATATGGGTGCGAGGGACCATGTAAAGTTCAATCCTTTGAACAACGGCATGATATCAGTCATACTGGTAAGGTCCTGTGTGTTTCCGATGTCACTAGAGGAAACAACCTTACTCATCGTGTTGGTAAACGATTTTGTGTTAAATCTGTTTACATTATTGGCAAAATTTGGATGGACGAGAACATTAAGACAAAGAACCATACAAACACAGTCATGTTTTGGCTAGTTCGTGATCGACGACCTTTTGGAACCCCAATGGACTTAGGGCAAGTGTTCAACATGTATGATAATGAACCCTCGACCGCCACTATCAAAAACGATCTTCGTGATCGTTACCAAGTTTTACGTAAGTTCGATTCAACTGTCACCGGAGGTCAATATGCGTCGAGGGAAGCAAATGTTATCAAGAGATTTTGGCGTGTCAACAATTATGTGGTGTACAACCACCAAGAAGCTGCTAAGTATGAAAATCATACTGAAAATGCATTATTATTGTATATGGCATGTACTCATGCCTCAAACCCAGTGTATGCAACATTAAAGATCAGGATCTATTTCTATGATTCTATCTCAAATTAA
Protein Sequence MPKRNFDMAFSTPRPSVRRRLNFDTPSATPMSVRRTPSTSRRRAWTNRPMNRKPRIYRLYRSRDVPYGCEGPCKVQSFEQRHDISHTGKVLCVSDVTRGNNLTHRVGKRFCVKSVYIIGKIWMDENIKTKNHTNTVMFWLVRDRRPFGTPMDLGQVFNMYDNEPSTATIKNDLRDRYQVLRKFDSTVTGGQYASREANVIKRFWRVNNYVVYNHQEAAKYENHTENALLLYMACTHASNPVYATLKIRIYFYDSISN

NCBI Accession YP_009029990.1
Location 1073-1483
Protein Name AC3
Coding Region ATGACGGATTCACGCACAGGGGAATCCATCACTGCAGCTCAACTACAGAGTGGCGTGTTTATCTGGGAGCTAAAGAATCCCCTGTCTTTCAAGATCCTGGAGCATCACGAGGGATTCATGTTCGATCCGAACCAACACAGAACCAAGATCCGCATAATGTTCAACCACGGGTTGAAGAAAGCGTTGGGGATACACAAGGCATTCTTGGATTTAGTGATTTACCATCGATTGACTCCGCAATCTGGGCGGATCTTGAATGTATTCAGGAACTTCCTTTTTAGATTTTTAAATAATTTAGGAATTATTTCGATGAACAATGTATTACGCAGTTGCGAATATGTATTGTATGATGTATTTCAGCGAGTCGAAGCTGTTGATTTCGAATTTAATGTACAATGGAAGTTATATTAA
Protein Sequence MTDSRTGESITAAQLQSGVFIWELKNPLSFKILEHHEGFMFDPNQHRTKIRIMFNHGLKKALGIHKAFLDLVIYHRLTPQSGRILNVFRNFLFRFLNNLGIISMNNVLRSCEYVLYDVFQRVEAVDFEFNVQWKLY

NCBI Accession YP_009029991.1
Location 1203-1631
Protein Name AC2
Coding Region ATGCGGTCTTCATCACCCTCGAACAGCCATTGTTCTCTACCGAGCATCAAGGCACAGCATCGACAAGCGAAGAAGCGCAAAACGATTCGGCGTAAGCGAATCGATCTGACCTGTGGCTGTTCGTATTACCTGAATATCAACTGCCGGAATGACGGATTCACGCACAGGGGAATCCATCACTGCAGCTCAACTACAGAGTGGCGTGTTTATCTGGGAGCTAAAGAATCCCCTGTCTTTCAAGATCCTGGAGCATCACGAGGGATTCATGTTCGATCCGAACCAACACAGAACCAAGATCCGCATAATGTTCAACCACGGGTTGAAGAAAGCGTTGGGGATACACAAGGCATTCTTGGATTTAGTGATTTACCATCGATTGACTCCGCAATCTGGGCGGATCTTGAATGTATTCAGGAACTTCCTTTTTAG
Protein Sequence MRSSSPSNSHCSLPSIKAQHRQAKKRKTIRRKRIDLTCGCSYYLNINCRNDGFTHRGIHHCSSTTEWRVYLGAKESPVFQDPGASRGIHVRSEPTQNQDPHNVQPRVEESVGDTQGILGFSDLPSIDSAIWADLECIQELPF

NCBI Accession YP_009029992.1
Location 1537-2634
Protein Name AC1
Coding Region ATGAGAGCTCCAGGCTTCCGCATATCTGCCAGAAATATATTTCTGACCTACCCCAAATGCTCTCTCTCAAAGGAAGAAGCTCTCGAGCAGCTCTGTCGCATCGAGTGTCCGTCGGACAAATTGTTCATCAGAGTGGCACAAGAAGCACATCAAGATGGGACTATGCATCTCCATGCCCTCGTCCAGTTCAAGGGTAAGGCCCAGTTCCGAAATGCAAGACATTTCGACCTTACCCATCCTCATAGCACACAGGTTTTCCATGGAAATGTCCAGGGAGCAAAGAGCTCATCTGATGTCAAATCCTACATCACCAAGGACGGTGATTACGTCGACTGGGGAACATTTCAGATCGACGGACGATCTGCTAGAGGAGGTCGTCAGACAGCTGACGATGCTGTAGCATCGGCGTTGAATTCCGGTACGGTTCAAGGTGCTCTGAACATTATCAAAGAATTACTTCCACACAATTATGTGTTCCAGTATCATAATCTGAGATGTAACCTTGAACGAATATTCGCTCCTCCGATTGCAGTTTACACGTCATATTACAAGCCTGCCGACTTTAGTCAAGTGCCGTCTGTTATGACAGAATGGGCAGAAAATAACGTTGTTGATCCTTCGTGGAGGAGCGACCCCGCTGCGCGGCCGAGAAGACCGATGAGCATCGTTGTTGAAGGAGCAACAAGAACAGGGAAGACGTTATGGGCACGGTCATTAGGAGTCCATAATTACATGTGTGGACACCTGGATCTTAGCCCTAAGATATTTTCAAATGATGCTTGGTATAACGTCATTGATGACGTTGATCCGCATTATCTAAAGCATTTTAAAGAGTTTATGGGGGCCCAGATGGACTGGCAAAGCAACATCAAATACGGTAAGCCCACTCAAATTAAAGGTGGGATACCCACCATCTTTCTTTGCAATCCAGGACCACGTTCGTCCTATAAAGAGTTCCTTGATGAGGAACAGAACGAATCATTGAAGGAGTGGGCTTACAAGAATGCGGTCTTCATCACCCTCGAACAGCCATTGTTCTCTACCGAGCATCAAGGCACAGCATCGACAAGCGAAGAAGCGCAAAACGATTCGGCGTAA
Protein Sequence MRAPGFRISARNIFLTYPKCSLSKEEALEQLCRIECPSDKLFIRVAQEAHQDGTMHLHALVQFKGKAQFRNARHFDLTHPHSTQVFHGNVQGAKSSSDVKSYITKDGDYVDWGTFQIDGRSARGGRQTADDAVASALNSGTVQGALNIIKELLPHNYVFQYHNLRCNLERIFAPPIAVYTSYYKPADFSQVPSVMTEWAENNVVDPSWRSDPAARPRRPMSIVVEGATRTGKTLWARSLGVHNYMCGHLDLSPKIFSNDAWYNVIDDVDPHYLKHFKEFMGAQMDWQSNIKYGKPTQIKGGIPTIFLCNPGPRSSYKEFLDEEQNESLKEWAYKNAVFITLEQPLFSTEHQGTASTSEEAQNDSA

NCBI Accession YP_009029993.1
Location 2235-2480
Protein Name AC4
Coding Region ATGGGACTATGCATCTCCATGCCCTCGTCCAGTTCAAGGGTAAGGCCCAGTTCCGAAATGCAAGACATTTCGACCTTACCCATCCTCATAGCACACAGGTTTTCCATGGAAATGTCCAGGGAGCAAAGAGCTCATCTGATGTCAAATCCTACATCACCAAGGACGGTGATTACGTCGACTGGGGAACATTTCAGATCGACGGACGATCTGCTAGAGGAGGTCGTCAGACAGCTGACGATGCTGTAG
Protein Sequence MGLCISMPSSSSRVRPSSEMQDISTLPILIAHRFSMEMSREQRAHLMSNPTSPRTVITSTGEHFRSTDDLLEEVVRQLTML

References More References in PubMed

1

Transovarial Transmission of Dolichos Yellow Mosaic Virus by Its Vector, Bemisia tabaci Asia II 1.

Ghosh A, et al.  Front Microbiol. 2021 Oct 25;12:755155. doi: 10.3389/fmicb.2021.755155. eCollection 2021.

PMID: 34759905

2

Evidence of seed transmission of dolichos yellow mosaic virus, a begomovirus infecting lablab-bean in India.

Suruthi V, et al.  Virusdisease. 2018 Dec;29(4):506-512. doi: 10.1007/s13337-018-0494-9. Epub 2018 Sep 25.

PMID: 30539054

3

Legume yellow mosaic viruses: genetically isolated begomoviruses.

Qazi J, et al.  Mol Plant Pathol. 2007 Jul;8(4):343-8. doi: 10.1111/j.1364-3703.2007.00402.x.

PMID: 20507504

4

First Report of Herbacious Hosts for Citrus yellow mosaic badna virus from India.

Aparna GS, et al.  Plant Dis. 2002 Aug;86(8):920. doi: 10.1094/PDIS.2002.86.8.920A.

PMID: 30818652

5

Cloning, restriction mapping and phylogenetic relationship of genomic components of MYMIV from Lablab purpureus.

Singh SK, et al.  Bioresour Technol. 2006 Oct;97(15):1807-14. doi: 10.1016/j.biortech.2005.09.004. Epub 2005 Oct 18.

PMID: 16242317

6

Molecular Approach Coupled with Biochemical Attributes to Elucidate the Presence of DYMV in Leaf Samples of Lablab purpureus. L Genotypes.

Rai N, et al.  Appl Biochem Biotechnol. 2016 Mar;178(5):876-90. doi: 10.1007/s12010-015-1915-5. Epub 2015 Nov 5.

PMID: 26541159