Desmodium leaf distortion virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_000869465.1
Isolate Mexico: Yucatan
Release date 2015/2/13
Submitter Hernandez-Zepeda,C., Idris,A.M., Carnevali,G., Brown,J.K., Moreno-Valenzuela,O.A.
Host
Vector
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_008494
ACTGGATGGCCGCGCGATTTTGGTGTCTTTACTTTTTCTGGTCCAATGAAATTGCGCCTGGCGAGCCTAGATATTTGAAACAACTTAGTGCGCAAGTTGTGAGCGTCTTTATAAATTAAAGACATATAGGGCCACCTTCTTTAGTTCAAAATGCCTAAGCGCGATGCCCCGTGGCGCTCTATGGCTGGGACCTCAAAGGTTAGTCGGGCTGCTAACTATTCTCCTCGTGCAGGTAATGGCCCAAAGTTGAACAGGGCCTCAGAATGGGTTAACAGGCCCATGTATAGGAAGCCCAGGATCTACCGGACTTTGAGGTCCCCTGATGTGCCCAGAGGCTGTGAAGGTCCTTGTAAGGTCCAGTCCTATGAACAGCGCCACGACATATCACACGTCGGGAAGGTCATGTGCATATCTGATGTGACACGTGGTAATGGCATTACCCACCGTGTGGGTAAGCGTTTTTGTGTTAAGTCTGTGTATATTCTAGGTAAGGTCTGGATGGATGAGAACATCAAGTTGAAGAATCACACGAACAGTGTGATGTTCTGGTTAGTCAGGGACCGTAGACCCTACGGTACTCCAATGGATTTCGGGCAGGTGTTCAACATGTTCGATAACGAGCCTAGCACTGCCACTGTTAAGAACGATCTCCGTGATCGTTACCGGGTGATGCACAAGTTCTATGCCAAGGTGACAGGTGGACAGTACGCCAGCAATGAACAGGCGATAGTCAAGAGGTTCTGGAGGATCAACACTCATGTGGTCTATAATCATCAGGAGGCTGCCAAGTATGAGAATCATACGGAGAACGCCCTATTATTGTATATGGCATGTACTCATGCCTCTAACCTTGTATATGCAACTCTGAAGATTCGAATCTATTTTTATGATTCGATAATGAATTAATAAAATTTGAATTTTATTTCATGATTTTCAAGTACATCATGGACATAACTTCTGGCTGTTGCGAAACGAACAGCCCTAATTACATTGTTTAAGCCAATTATCCCTAATTGGTCCAAATACATATTAACTAACTGTCTAAACCTAGTTAAATAGGTCAACCCAGAAGCTGTCGTCCAAGTCGTCCAGACTTGGAAGTTCAGGTAGGCTTTGTGGAGATGCAACGCTCTCCTCAGGTTGTGGTTGAACCGTATTTGTACGGTGTATATCCTGGTGTTGGTGTACAAGGGGTCCTCTACTTTGCACATCTTGAAATAGAGGGGATTTTCTATCTCCCAGATATACACGCCATTCTCTGCCTGATGTGCAGTGATGATTTCCCCTGTGCGTGAATCCATGCCCGGTGCAGTCTATGTGGAAGTAGATGGAGCAACCGCAATCTAAATCAATCCGGCGTCGTCTGACCGCCCTCTTCTTGGCTTGCCTGTGGGCCTTCTTGATAGAGGGCGGATGTGAGGGTGATGAAGATCGCATTCTTCAGAGTCCAGTTCCTGAGTGATGCGTTTTCAGCTTTGTCGAGGAAATCTTTATAGCTGGCACCCTCACCCGGATTGCAAAGCACGATTGAGGGGATCCCTCCTTTAATTTGAACTGGCTTTCCGTATTTGCAATTTGACTGCCAGTTCTTTTGGGCCCCTATGAGTTCTTTCCAGTGCTTTAACTTTAGATATTGCGGTGCGACGTCATCAATGACGTTATACTCCACTTCATTCGAGTAGACCCTGTTATTGAAGTCCAAATGTCCACTGAGATAATTATGTGGGCCTAAAGAACGAGCCCACATTGTTTTGCCTGTCCTTGATTCACCTTCCACTATTATACTAATAGGTCTCTCCGGCCGCGCAGCGGAACTCCGACCAAAATAGTCATCTGCCCACTCTTGCATCTCGTCCGGCACGTTAGTGAAAGATGATAGTCTATAGGGAGGAGTCCATGGCTCCGGAGGCTTTGCAAAGAGGCGTTCTATATTAGCCTTGATGTTATGGTAGCTTACAATGAACGTCCTTGGATCTCCGGCCCTGATAATGTCAAGAGCCTCTGCAACACCAGGTGCATTGACGGCGTTATGGAAGACGTCGTCCTTATTTGCCTTTGTTCCGCCAGGCACCTTGTATTGTCCGGATTCACAATAATCACCCTCTTTGGTGATGTAATTCCGGACGGCGTTGGAGTCTTTGGCAGCCTGGACATTTGGGTGAAAGTTGGCAGACCTTCTCGGGTGAGTGAGGTCGAAAAATCTAGCATCCTTGATGTTTGACTTGCCGGAGAGCTGGAGAAGACAGTGGAGGTGAGGGAACCCGTCTGAATGTTCCTCTCTTGCGACTCTGATGTATACTGGTTTGACGACTGACCATGACAGGTTTTGAAGCATCTGAAGAGCTTCATCTTTTGGGATATCACACTGGGGATATGTTAAGAATATATTTCTGGCAGCTAAACGAAAGGTTTTAGGTTTCAGTGGCATATTTGTAATAATAGGAAGAGACACCAGGGGGAGCTCTAAACTTCTCTCCATTATTTTGGTGTCTTGGTGTCATATATATACATAAAGGCTTATGGAGGAATCTTTAGACACCAGGGGTAAAAGCGGCCATCCTATAATATT

NC_008495
ACTGGATGGCCGCGCGATTTTGGTGTTCGGCCCAGGCCCATTGGCGCTGTCCTTGTTGTGCTCCCTTCCCCTTGGTGTGTTCGTTCCCTCCGTCTTTTCCCTGGTGCGTCCTGGGACCCCCCTCTCTCCGTCTTTTACCTCTCATTTTAATTTAAAGAGACTTTAAATTAAATCTGCCTTGTCTTTAGCCAATTTCGAGATTTTGACTGATAGACCTGGCAGCAGTCGACGTGGTCGATTTTGGACCCTGCTTGTATGCTTATGTCGAAATTGAGCTAGAGGTGTACTATACATCTTACGTGGACCATTCACGTTTGACCTGTCGAGCCAAATTAATATTAGCCTAACTGAATCGCTTGTATATATCGGAGATGTAATCACCCATTGGATATCCATATCTGAACATGTACCCGTCCAGATATCGACGTGGTTCTATCTATAATCAACCACGTGGTTACCCTCGTAGCCACGTGTTTAGGCGACAACCAATTGTTAAACGCCACGATGGTAGACGTCGACATATTCTGTCTGGGAAATTACCTGACGAGCCCAAGTTGACGAGCCAAACCATACATGAGAACCAGTATGGCCCAGAGTTTTCCATGGCCCATAACACGTCCGTTTCGACATTCATTAGCTACCCTGATATGGGTAAGTCTTTTCCTAATCGATCTAGGTCGTATATCAAGTTGAAACGGCTTCGTTTCAAGGGAACTGTCAAAGTTGAACGTGTTCATTCCGATGTGAATATGGTCGCTACATCACCTAAGACCGAAGGTGTTTTCTCGCTGGTCATAGTCGTCGACCGCAAACCTCACATCGGACCTTCTGGTGGTCTTCCGTCCTTTGATGAACTATTTGGTGCAAGGATCCACAGTCACGGTAACCTGGCTATAACTCCAGGTATGAAGGAGCGGTTCTATTTACGCCACGTGTTGAAGCGTGTATTATCCGTGGAGAAGGATAGCCTGATGGTCGACATAGAAGGAACCGCCACCCTGTCGAACAGGCGTTTTAATTGTTGGTCCAGTTTTAAGGATCTCGAGGTCGAGTCATGTAAGGGTGTGTATGCTAACATAAGCAAGAACGCCCTGTTAGTCTATTACTGTTGGATGTCCGATACCATGTCTAAAGCATCCACATATGTATCATATGACCTGGATTATATTGGCTGAATAAAGATTTATTATCAATGCAAAATTTATACAAATTTTGACTTTAGAGACATTTTAACTATTTATCAAAAGACTTGAGCTGAGATGAACTACAATTATTCTTAATACATTCTTGGACTGTGGACCTGACAAGTTCGTTTAATTGGGCCACTGACATTGTTATGTTGGACTGAGCCCTCCTTGCTCCAACAATAGACGCAGACTCTCCTGGATCCAGTACGCTTGTTCCCAGCCTATTTAGATCTCGATACGGGTGCAACTCGTTCTCGATCTCTGAGTCAGCATCCGATGGTCCTACTCCTATTGTGCTTCTGGAAGCCCATGATTCTCCGGGCCTGATTTCAATTGGGCCTCGCAAACCTAGTCTTGACATGGATGCACACCGGATGGGCTTCCTCTCCCATCTCCCGTAGTCCACGTGCGAGAAGTCCACATCCTTCTCGGTGAATTGCTTGGATAAGATCTTGACCGTCGGTGCTTTAAATGGGATATCCACCGAGTGTTTTGCCGTGGACAATTTCAGCTTCCCTTTGAATTTGGCGAAGTGGGTCCTTTGATGGACGTTTGTATCAGAAACTCTGTAATAGAGTTTCCAAGGGATTGGGTCTTTCAAGGAGAAGAAGGAAGCTGAGAAGTAGTGGAGATCTATGTTACATCTGATCGGAAATGTCCAGGTTGCCTGTAACGACTCGTTATCCGTCATTCTTTGGTCGTGGATCTCCACTATCACAGTCCCGGCGGCGTTGATCGGTACCTGTTGCCTGTACTCGATTACGCAGTGATCGATTTTCATACAGCTCCGACTGAGTCTTGCCGTTAGTTGAGCCGCCGCTGACGGAAACTGCAGGATTATCTCAGTTAGGTCATGGGAGAGCTGATATTCATCCCTCTGGGACTCTATGTAGTTGTATGCATGAGGAGGATTTGCTAACTGAGAATTCATTTATGAAAATTTGGTCGCGCTAGCGAGATCTGTCTAATTATTTGAAGACTATGTCAAGAGCTTGAGCAAATTCAGTTGGAAATCAATTTCTGGGGAAGACACTTTTTGTGAAAAAGAAGAGTACCGAGGAAGGAGAAGATGAAAACCTAGATCTGACAAGGGTTGGGTTTATCAGAGACCTGACAAGGTTTATATAGAGAACCAGGTGTTTAGTGTTTAGCTTCAGAATTGGCTAATGGCAATCTTGTAATAATAGGTTATGACACCATGGGGAGACACCAGGGGGAGCTCTCAACTTCTCTCCATTATTTTGGTGTCTTGGTGTCATATATATACATAAAGGCTTATGGAGGAATCTATAGACACCAGGGGTAAAAGCGGCCATCCTATAATATT

Gene Information

NCBI Accession YP_794168.1
Location 151-906
Gene Name AV1
Protein Name coat protein
Coding Region ATGCCTAAGCGCGATGCCCCGTGGCGCTCTATGGCTGGGACCTCAAAGGTTAGTCGGGCTGCTAACTATTCTCCTCGTGCAGGTAATGGCCCAAAGTTGAACAGGGCCTCAGAATGGGTTAACAGGCCCATGTATAGGAAGCCCAGGATCTACCGGACTTTGAGGTCCCCTGATGTGCCCAGAGGCTGTGAAGGTCCTTGTAAGGTCCAGTCCTATGAACAGCGCCACGACATATCACACGTCGGGAAGGTCATGTGCATATCTGATGTGACACGTGGTAATGGCATTACCCACCGTGTGGGTAAGCGTTTTTGTGTTAAGTCTGTGTATATTCTAGGTAAGGTCTGGATGGATGAGAACATCAAGTTGAAGAATCACACGAACAGTGTGATGTTCTGGTTAGTCAGGGACCGTAGACCCTACGGTACTCCAATGGATTTCGGGCAGGTGTTCAACATGTTCGATAACGAGCCTAGCACTGCCACTGTTAAGAACGATCTCCGTGATCGTTACCGGGTGATGCACAAGTTCTATGCCAAGGTGACAGGTGGACAGTACGCCAGCAATGAACAGGCGATAGTCAAGAGGTTCTGGAGGATCAACACTCATGTGGTCTATAATCATCAGGAGGCTGCCAAGTATGAGAATCATACGGAGAACGCCCTATTATTGTATATGGCATGTACTCATGCCTCTAACCTTGTATATGCAACTCTGAAGATTCGAATCTATTTTTATGATTCGATAATGAATTAA
Protein Sequence MPKRDAPWRSMAGTSKVSRAANYSPRAGNGPKLNRASEWVNRPMYRKPRIYRTLRSPDVPRGCEGPCKVQSYEQRHDISHVGKVMCISDVTRGNGITHRVGKRFCVKSVYILGKVWMDENIKLKNHTNSVMFWLVRDRRPYGTPMDFGQVFNMFDNEPSTATVKNDLRDRYRVMHKFYAKVTGGQYASNEQAIVKRFWRINTHVVYNHQEAAKYENHTENALLLYMACTHASNLVYATLKIRIYFYDSIMN

NCBI Accession YP_794169.1
Location 903-1301
Gene Name AC3
Protein Name replication enhancer protein
Coding Region ATGGATTCACGCACAGGGGAAATCATCACTGCACATCAGGCAGAGAATGGCGTGTATATCTGGGAGATAGAAAATCCCCTCTATTTCAAGATGTGCAAAGTAGAGGACCCCTTGTACACCAACACCAGGATATACACCGTACAAATACGGTTCAACCACAACCTGAGGAGAGCGTTGCATCTCCACAAAGCCTACCTGAACTTCCAAGTCTGGACGACTTGGACGACAGCTTCTGGGTTGACCTATTTAACTAGGTTTAGACAGTTAGTTAATATGTATTTGGACCAATTAGGGATAATTGGCTTAAACAATGTAATTAGGGCTGTTCGTTTCGCAACAGCCAGAAGTTATGTCCATGATGTACTTGAAAATCATGAAATAAAATTCAAATTTTATTAA
Protein Sequence MDSRTGEIITAHQAENGVYIWEIENPLYFKMCKVEDPLYTNTRIYTVQIRFNHNLRRALHLHKAYLNFQVWTTWTTASGLTYLTRFRQLVNMYLDQLGIIGLNNVIRAVRFATARSYVHDVLENHEIKFKFY

NCBI Accession YP_794170.1
Location 1048-1437
Gene Name AC2
Protein Name transactivator protein
Coding Region ATGCGATCTTCATCACCCTCACATCCGCCCTCTATCAAGAAGGCCCACAGGCAAGCCAAGAAGAGGGCGGTCAGACGACGCCGGATTGATTTAGATTGCGGTTGCTCCATCTACTTCCACATAGACTGCACCGGGCATGGATTCACGCACAGGGGAAATCATCACTGCACATCAGGCAGAGAATGGCGTGTATATCTGGGAGATAGAAAATCCCCTCTATTTCAAGATGTGCAAAGTAGAGGACCCCTTGTACACCAACACCAGGATATACACCGTACAAATACGGTTCAACCACAACCTGAGGAGAGCGTTGCATCTCCACAAAGCCTACCTGAACTTCCAAGTCTGGACGACTTGGACGACAGCTTCTGGGTTGACCTATTTAACTAG
Protein Sequence MRSSSPSHPPSIKKAHRQAKKRAVRRRRIDLDCGCSIYFHIDCTGHGFTHRGNHHCTSGREWRVYLGDRKSPLFQDVQSRGPLVHQHQDIHRTNTVQPQPEESVASPQSLPELPSLDDLDDSFWVDLFN

NCBI Accession YP_794171.1
Location 1349-2428
Gene Name AC1
Protein Name REP protein
Coding Region ATGCCACTGAAACCTAAAACCTTTCGTTTAGCTGCCAGAAATATATTCTTAACATATCCCCAGTGTGATATCCCAAAAGATGAAGCTCTTCAGATGCTTCAAAACCTGTCATGGTCAGTCGTCAAACCAGTATACATCAGAGTCGCAAGAGAGGAACATTCAGACGGGTTCCCTCACCTCCACTGTCTTCTCCAGCTCTCCGGCAAGTCAAACATCAAGGATGCTAGATTTTTCGACCTCACTCACCCGAGAAGGTCTGCCAACTTTCACCCAAATGTCCAGGCTGCCAAAGACTCCAACGCCGTCCGGAATTACATCACCAAAGAGGGTGATTATTGTGAATCCGGACAATACAAGGTGCCTGGCGGAACAAAGGCAAATAAGGACGACGTCTTCCATAACGCCGTCAATGCACCTGGTGTTGCAGAGGCTCTTGACATTATCAGGGCCGGAGATCCAAGGACGTTCATTGTAAGCTACCATAACATCAAGGCTAATATAGAACGCCTCTTTGCAAAGCCTCCGGAGCCATGGACTCCTCCCTATAGACTATCATCTTTCACTAACGTGCCGGACGAGATGCAAGAGTGGGCAGATGACTATTTTGGTCGGAGTTCCGCTGCGCGGCCGGAGAGACCTATTAGTATAATAGTGGAAGGTGAATCAAGGACAGGCAAAACAATGTGGGCTCGTTCTTTAGGCCCACATAATTATCTCAGTGGACATTTGGACTTCAATAACAGGGTCTACTCGAATGAAGTGGAGTATAACGTCATTGATGACGTCGCACCGCAATATCTAAAGTTAAAGCACTGGAAAGAACTCATAGGGGCCCAAAAGAACTGGCAGTCAAATTGCAAATACGGAAAGCCAGTTCAAATTAAAGGAGGGATCCCCTCAATCGTGCTTTGCAATCCGGGTGAGGGTGCCAGCTATAAAGATTTCCTCGACAAAGCTGAAAACGCATCACTCAGGAACTGGACTCTGAAGAATGCGATCTTCATCACCCTCACATCCGCCCTCTATCAAGAAGGCCCACAGGCAAGCCAAGAAGAGGGCGGTCAGACGACGCCGGATTGA
Protein Sequence MPLKPKTFRLAARNIFLTYPQCDIPKDEALQMLQNLSWSVVKPVYIRVAREEHSDGFPHLHCLLQLSGKSNIKDARFFDLTHPRRSANFHPNVQAAKDSNAVRNYITKEGDYCESGQYKVPGGTKANKDDVFHNAVNAPGVAEALDIIRAGDPRTFIVSYHNIKANIERLFAKPPEPWTPPYRLSSFTNVPDEMQEWADDYFGRSSAARPERPISIIVEGESRTGKTMWARSLGPHNYLSGHLDFNNRVYSNEVEYNVIDDVAPQYLKLKHWKELIGAQKNWQSNCKYGKPVQIKGGIPSIVLCNPGEGASYKDFLDKAENASLRNWTLKNAIFITLTSALYQEGPQASQEEGGQTTPD

NCBI Accession YP_794172.1
Location 405-1175
Gene Name BV1
Protein Name BV1
Coding Region ATGTACCCGTCCAGATATCGACGTGGTTCTATCTATAATCAACCACGTGGTTACCCTCGTAGCCACGTGTTTAGGCGACAACCAATTGTTAAACGCCACGATGGTAGACGTCGACATATTCTGTCTGGGAAATTACCTGACGAGCCCAAGTTGACGAGCCAAACCATACATGAGAACCAGTATGGCCCAGAGTTTTCCATGGCCCATAACACGTCCGTTTCGACATTCATTAGCTACCCTGATATGGGTAAGTCTTTTCCTAATCGATCTAGGTCGTATATCAAGTTGAAACGGCTTCGTTTCAAGGGAACTGTCAAAGTTGAACGTGTTCATTCCGATGTGAATATGGTCGCTACATCACCTAAGACCGAAGGTGTTTTCTCGCTGGTCATAGTCGTCGACCGCAAACCTCACATCGGACCTTCTGGTGGTCTTCCGTCCTTTGATGAACTATTTGGTGCAAGGATCCACAGTCACGGTAACCTGGCTATAACTCCAGGTATGAAGGAGCGGTTCTATTTACGCCACGTGTTGAAGCGTGTATTATCCGTGGAGAAGGATAGCCTGATGGTCGACATAGAAGGAACCGCCACCCTGTCGAACAGGCGTTTTAATTGTTGGTCCAGTTTTAAGGATCTCGAGGTCGAGTCATGTAAGGGTGTGTATGCTAACATAAGCAAGAACGCCCTGTTAGTCTATTACTGTTGGATGTCCGATACCATGTCTAAAGCATCCACATATGTATCATATGACCTGGATTATATTGGCTGA
Protein Sequence MYPSRYRRGSIYNQPRGYPRSHVFRRQPIVKRHDGRRRHILSGKLPDEPKLTSQTIHENQYGPEFSMAHNTSVSTFISYPDMGKSFPNRSRSYIKLKRLRFKGTVKVERVHSDVNMVATSPKTEGVFSLVIVVDRKPHIGPSGGLPSFDELFGARIHSHGNLAITPGMKERFYLRHVLKRVLSVEKDSLMVDIEGTATLSNRRFNCWSSFKDLEVESCKGVYANISKNALLVYYCWMSDTMSKASTYVSYDLDYIG

NCBI Accession YP_794173.1
Location 1234-2118
Gene Name BC1
Protein Name movement protein
Coding Region ATGAATTCTCAGTTAGCAAATCCTCCTCATGCATACAACTACATAGAGTCCCAGAGGGATGAATATCAGCTCTCCCATGACCTAACTGAGATAATCCTGCAGTTTCCGTCAGCGGCGGCTCAACTAACGGCAAGACTCAGTCGGAGCTGTATGAAAATCGATCACTGCGTAATCGAGTACAGGCAACAGGTACCGATCAACGCCGCCGGGACTGTGATAGTGGAGATCCACGACCAAAGAATGACGGATAACGAGTCGTTACAGGCAACCTGGACATTTCCGATCAGATGTAACATAGATCTCCACTACTTCTCAGCTTCCTTCTTCTCCTTGAAAGACCCAATCCCTTGGAAACTCTATTACAGAGTTTCTGATACAAACGTCCATCAAAGGACCCACTTCGCCAAATTCAAAGGGAAGCTGAAATTGTCCACGGCAAAACACTCGGTGGATATCCCATTTAAAGCACCGACGGTCAAGATCTTATCCAAGCAATTCACCGAGAAGGATGTGGACTTCTCGCACGTGGACTACGGGAGATGGGAGAGGAAGCCCATCCGGTGTGCATCCATGTCAAGACTAGGTTTGCGAGGCCCAATTGAAATCAGGCCCGGAGAATCATGGGCTTCCAGAAGCACAATAGGAGTAGGACCATCGGATGCTGACTCAGAGATCGAGAACGAGTTGCACCCGTATCGAGATCTAAATAGGCTGGGAACAAGCGTACTGGATCCAGGAGAGTCTGCGTCTATTGTTGGAGCAAGGAGGGCTCAGTCCAACATAACAATGTCAGTGGCCCAATTAAACGAACTTGTCAGGTCCACAGTCCAAGAATGTATTAAGAATAATTGTAGTTCATCTCAGCTCAAGTCTTTTGATAAATAG
Protein Sequence MNSQLANPPHAYNYIESQRDEYQLSHDLTEIILQFPSAAAQLTARLSRSCMKIDHCVIEYRQQVPINAAGTVIVEIHDQRMTDNESLQATWTFPIRCNIDLHYFSASFFSLKDPIPWKLYYRVSDTNVHQRTHFAKFKGKLKLSTAKHSVDIPFKAPTVKILSKQFTEKDVDFSHVDYGRWERKPIRCASMSRLGLRGPIEIRPGESWASRSTIGVGPSDADSEIENELHPYRDLNRLGTSVLDPGESASIVGARRAQSNITMSVAQLNELVRSTVQECIKNNCSSSQLKSFDK

References More References in PubMed

1

Molecular characterization and phylogenetic relationships of Desmodium leaf distortion virus (DeLDV): a new begomovirus infecting Desmodium glabrum in Yucatan, Mexico.

Hernández-Zepeda C, et al.  Virus Genes. 2009 Dec;39(3):371-4. doi: 10.1007/s11262-009-0398-2. Epub 2009 Sep 16.

PMID: 19757008

2

Molecular and Biological Characterization of a New World Mono-/Bipartite Begomovirus/Deltasatellite Complex Infecting Corchorus siliquosus.

Fiallo-Olivé E, et al.  Front Microbiol. 2020 Jul 23;11:1755. doi: 10.3389/fmicb.2020.01755. eCollection 2020.

PMID: 32793176

3

Preliminary identification and coat protein gene phylogenetic relationships of begomoviruses associated with native flora and cultivated plants from the Yucatan Peninsula of Mexico.

Hernández-Zepeda C, et al.  Virus Genes. 2007 Dec;35(3):825-33. doi: 10.1007/s11262-007-0149-1. Epub 2007 Aug 8.

PMID: 17682933