Cnidoscolus mosaic leaf deformation virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_003029265.2
Isolate Brazil
Release date 2018/12/27
Host
Vector
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_040184
ACCGGATGGCCGCGCCCCCTCCCCGTACGACCCGCGCCTCGACCCGCGCTTTACCCGACCCGTAGCGCATTGTCGGCCACTACGTTGTTGTGTCATTGTCAATGTGGGGCCGTGTCAGAAACATATACGACGACTGGCCAATCAGAAGTATAACTGATAGTCTGAATATTTAACTTCTTGGGTGACGAGTATATAAAGAACGATAATGATTATCTTGTGTGGCCAGTCTTTAATTTGAAATTCACATGTGAGGATACTTTTGGCGCTGATTGACGTGTTTTATTAAACACAATAAGATGCAATTGATGTGGTGAATTTCAACGGCGAATTATTGGTTTACGTGTCTCATTTGTAGCCAAATTTATATTGGATATTTGTTCGTGCAATAATTGTGGATATGTGAACTGGACCAATAACATTCGCCATGTGTATCTATTACATTCTATTAAGAATATGGTGAACTATATATATTTGTTTAGGTGACATACGAACATGTGTATTAGCACAACAGGATAATGTATGTTAGTAGAAATAAACGTGGTTGGACGTCCAATTATCGTCGGAATACGTCGCGAAGGACGACATTTAAGCGCATCTACTATGCGCCACGCGTCGATGGGAAACGTCGAAGTAGTAAGACCAACAAGGTTCAAGAAGAAGGCAAAATTTCGAATCAGGTGATGCACGAGAATCAATATGGGCCTGACTTCGTTTTGATGCATAATACCGCTATATCGACGTACATAACTTATCCTTCACTGAGTAAAACTCAACCGTGTCGTTCAAGAGCATATATTAAGCTTCATCGTCTAAGTTTCAAAGGGACGGTTAGGATTGAAACTGCCCAAGCAGACGTGAACATGACTAGTTCAAATCCAAAGATCGAAGGAGTATTCACATTAGTTATTGTCGTCGATCGCAAACCGCATATTAATTCAACTGGGAGTCTTCACACATTTGATGAACTATTCGGTGCAAGGATTAATAGTCATGGGAATTTGTCCATAAATTCTTCTCTGAAGGAACGATTTTATATACGACATGTGTTTAAGCGTGTACTATCAACTGAGAATGATAGTGTGATGGTGGATATAGAAGGAACGACATCGTTTTCTAATAAGCGTTTTAACTGCTGGGCAAGTTTTAGGGACGTAGATCATGATTCATGTAATGGCGTATATGCGAACATAAGTAAAAACGCCTTATTAGTTTATTATTGCTGGATGTCTGACACGGCATCTCAAGCATCGTCATTTGTGTCATTTGATCTAGATTATGTTGGTTAATACACTGAATAATTTACAATGCGCGCTTTATTATTTATTCGATAAATAATATTTTACTTCAACGATTTGGGCTCAGATGGAGTACAGTTCAGGTTAATGCACTCTTGGACTGTGGATCGAACGATATCGTTAATTTGGGCTAATGACAAAGTGATGTTGGATTGTGCCCTCTGGGCCCCAATAATTGATGCCGAGTCGCCTGGATCTAATATTGTAGAGCCCAATTTGTTTAGTTGCTTATATGGATGTAGTTCGTTTCCCACCTCCGAGTCAGGATATGAATTGTTTGGGCCTAAAGAACTCCTTGAAGCCCATGACTCACCGGGCTTAATTTCGATTGGGCCGTTTAGGCCTATTGTGGAGGTGGAAACGTTCCTGATTAATTTTCTTTCCCAATTCCCATAAGCCACATGGGAAAAGTCGACGTCTTTGTCTGTGAATTGTTTCGACAAGATCTTCACCGTTGGTGCCTTGAAAGGGATATCCACTGAGTGTTTAGCCGTCGACAGTTTCAATTTTCCCTTGAATTTGGCGAAATGTGTTCTTTGATGAACATTAGTGTCAGAGACTTTGTAATATAACTTCCAAGGAATTGGGTCTTTAAGAGAGAAGAATGACGACGAGAAATAATGCAGATCAATGTTGCATCGAATTGGAAATGTCCACGAGGCTTGTAATGATTCGTTGTCATTCATTCGCTTGTCGTGAATTTCCACTATGACCGAGCCAGTGGCGTTGATTGGCACTTGTTGCCGGTATTCGATAACACAGTGATCTATTTTCATGCAGCTCCGGCTGAGTCTTGCAGTAATTTGAGACGCTGTAGATGGAAATTGCAACACAATTTCTGTTAGGTCGTGAGACAGCTGATACTCATCTCGTTGGGATTCGATATAATTAAAAGCGTTAGGAGGAATTACTAATTGAGATTCCATAATTTATGAAAAATAGGCCGCGCAGCGGAATGGAATCACCCAAGTTAACAACTAAAGACGAATGGCAATAATTGAAACAGTGTGAGTGGAAGAGGATAAACTGATAATAAATAATGTGAACAAGAGATAGGCAAACTTGGTTTGGGATAATTGTTTCATATAACTGGATCTATTTATAGACTACTAATAATGGATAGGATTGACAGGAATGTTGTATTGAGGTATCGAAACGACGTGGTTTGATGGCATTTATGTAATAAGAAGGTTGGACACCGATTGGGGTCTCTTCAAACTTCCTCTAGCAATTGGGGTCTGGGGTCTTACTTATACTAGAAGCCCCAATAGAACTTCAAATCTCCATCGCACACGTGGCGGCCATCCGCTATAATATT

NC_038982
ACCGGATGGCCGCGCCCCCCCGCCTCTCTCGCTACGGCCCGGCCCATTCGTAGCGCATTGTCGCATTCGTTGTGGTCCCAAATGGATAAGGACCAATTATGAGTGTTACTGAAAGTCTAGATATTTAAGCAACTTGGTCGCTAAGTTGATATAAAGCGACAAGCGTGATGTAACCCGTCCGCTTTATTTCAGAATGCCTAAGCGGGACGCCCCATGGCGATTAATGGCGGGAACGTCCAAAGTTAGCCGCGGTGTCAGTTCATCCCCACGTGGTGGCATGGCGTTAATGAGTCCGATCGTGCGTAAGTTCAACAAGACCGCGGCTTGGGTTAATAGGCCCATGTACAAGAAGCCCAGAATATACAAGGTGCTCAGGACACCTGATGTGCCGTATGGCTGTGAGGGGCCTTGTAAGGTCCAGTCATACGAGTCCCGCCATGATGTATCGCATTCGGGTAAGGTAATTTGTATATCCGATGTGACACGGGGTAGTGGTATCACTCACCGTGTTGGTAAGCGTTTCTGCATAAAGTCTGTGTACATACTGGGGAAAATCTGGATGGATGATAACATCAAGCTTAAGAACCACACGAATAGTGTTATGTTCTGGTTGGTTAGGGACAGAAGACCGAACGGTACACCTATGGATTTCGGACATCTATTCAACATGTTCGATAACGAGCCGAGCACTGCTACGATTAAGAACGATCTTCGTGATCGTTTTCAAGTTATGCATAGGTTCTATGCCAAGGTGACAGGTGGTCAGTATGCCAGCAATGAACAGGCGTTAGTGAAGAGATTTTGGAAGGTCAACAATCACGTTGTGTATAACAACCAAGAAGCCGCTAGATACGAGAATCATACGGAGAACGCCCTCCTATTGTATATGGCGTGTACTCATGCATCGAATCCTGTATATGCAACCCTAAAAATTCGGATCTATTTTTATGATTCGATAACAAATTAATAAAGTTTATATTTTATTGAATGATTCTCGAGTACATGATTTACATACACCCTATCTGTTGCGAAACGAACAGCTCTAATTACAAGATTAATGGAGATAACTCCGACCTGATCTAAATACATATTGACTAAGTATGTAAATCTACTTAAATAAGTCCTCCCAGAAGCTGTCAGAGATGTCGTCCAGACTTGGAAGTTGAGGAAGCATTTGTGGAGATCCAATGCTTTCCTCAGGTTGTGGTTGAACCTGATCTGGACGTGGTACACCCTCGTGTTGGTGTACATTAGATCCTCCACGTTGATGATCTTGAAATAAAGGGGATTTGGAACTTCCCAGATAAACACGCCATTCTGTGCCTGAGGTGCAGTGATGGATTCCCCTGTGCGTGTATCCATGACCGTAGCAATCGATGTGTTGATATATGGTACAGCCGCACACCAGATCGATTCGACGTCGTCTAATCGCCCTCTTCTTGGCGGCTCTGTGTCTCGGTTTGATAGAGGGCGGAGTTGAGGAAGACGAATTTTGCATTATGGAGAGTCCAATTTTTGAGTGCGGCGTTTTCCTCTTTCTCGAGGAAATCTTTATAGCTGGACCCTTCGCCTGGATTGCACAGCACGATTGAAGGAACTCCACCTTTAATTTGAACTGGCTTTCCGTATTTGCAATTTGACTGCCAGTCCCTTTGGGCCCCAAGGAGTTCCTTCCAGTGCTTCATTTTTAGATATTGGGGAGTGATATCATCAATGACGTTATAATCAACGTCGTTACAATAAACTCGTGGATTAAAGTCTAAATGACCGCTAAGATAATTGTGAGACCCTAAGGCACGAGCCCACAATGTCTTCCCCGTTCGACTATGACCCTCGATAATCAAACTAATAGGTCTCACAGGCCGCGCAGCGGCAACTCTCCCAAAATAATCATCGGCCCACTCTTGCATCTCCTCTGGTACGTTAGTGAATGAGGAGAGTTGAAACGGAGGAACAAACGGTTCTGGAGCCTTTTGAAAAATACGTTCTAAATTGGAACGGATATTGTGGTGTTGAAGGACGAAGTCTTTGGGTTGTTCCTCCTTTAATATATTGAGGGCCTCCAAGATTGATCCTGAATTGAGGACCTTGGCATACGTGTCGTTGGCAGATTGCTTACCTCCTCTAGCAGATCTGCCGTCGATTTGGAAAACTCCATGATCAATGAAGTCTCCGTCTTTCTCCACATAGGTTTTAACGTCTGAGGAGCTCTTAGCTCCCTGAATGTTCGGATGGAAATGTGCTGACCTAGTTGAGGAGACGAGATCGAAGAACCTGTTGTTCTTGCAGTTGTATTTTCCCTCGAATTGAATGAGCACATGGAGGTGAGGTTGCCCATCTTCGTGTAATTCTCTTGACACACGAATGAATTTTTTATTTGTTGGGGTTTCCAGACCTAGCAATTGGGAAAGTGCCTCTTCTTTGGATAAGGAACATTTGGGATAAGTTAGGAAAAAATTCTTACTATTTACTCTAAAACGACGTGGTTCTGATGGCATTTTTGTAATAAGAAGGTTGGACACCGATTGGGGTCTCTTCAAACTTGCTCTGGCAATTGGGGTCTGGGGTCTTACTTATACTAGAACCCCCAATAGAACTTCCAATCTCCATCGCACACGTGGCGGCCATCCGCTATAATATT

Gene Information

NCBI Accession YP_009547928.1
Location 516-1286
Protein Name nuclear shuttle protein
Coding Region ATGTATGTTAGTAGAAATAAACGTGGTTGGACGTCCAATTATCGTCGGAATACGTCGCGAAGGACGACATTTAAGCGCATCTACTATGCGCCACGCGTCGATGGGAAACGTCGAAGTAGTAAGACCAACAAGGTTCAAGAAGAAGGCAAAATTTCGAATCAGGTGATGCACGAGAATCAATATGGGCCTGACTTCGTTTTGATGCATAATACCGCTATATCGACGTACATAACTTATCCTTCACTGAGTAAAACTCAACCGTGTCGTTCAAGAGCATATATTAAGCTTCATCGTCTAAGTTTCAAAGGGACGGTTAGGATTGAAACTGCCCAAGCAGACGTGAACATGACTAGTTCAAATCCAAAGATCGAAGGAGTATTCACATTAGTTATTGTCGTCGATCGCAAACCGCATATTAATTCAACTGGGAGTCTTCACACATTTGATGAACTATTCGGTGCAAGGATTAATAGTCATGGGAATTTGTCCATAAATTCTTCTCTGAAGGAACGATTTTATATACGACATGTGTTTAAGCGTGTACTATCAACTGAGAATGATAGTGTGATGGTGGATATAGAAGGAACGACATCGTTTTCTAATAAGCGTTTTAACTGCTGGGCAAGTTTTAGGGACGTAGATCATGATTCATGTAATGGCGTATATGCGAACATAAGTAAAAACGCCTTATTAGTTTATTATTGCTGGATGTCTGACACGGCATCTCAAGCATCGTCATTTGTGTCATTTGATCTAGATTATGTTGGTTAA
Protein Sequence MYVSRNKRGWTSNYRRNTSRRTTFKRIYYAPRVDGKRRSSKTNKVQEEGKISNQVMHENQYGPDFVLMHNTAISTYITYPSLSKTQPCRSRAYIKLHRLSFKGTVRIETAQADVNMTSSNPKIEGVFTLVIVVDRKPHINSTGSLHTFDELFGARINSHGNLSINSSLKERFYIRHVFKRVLSTENDSVMVDIEGTTSFSNKRFNCWASFRDVDHDSCNGVYANISKNALLVYYCWMSDTASQASSFVSFDLDYVG

NCBI Accession YP_009547929.1
Location 1340-2221
Protein Name movement protein
Coding Region ATGGAATCTCAATTAGTAATTCCTCCTAACGCTTTTAATTATATCGAATCCCAACGAGATGAGTATCAGCTGTCTCACGACCTAACAGAAATTGTGTTGCAATTTCCATCTACAGCGTCTCAAATTACTGCAAGACTCAGCCGGAGCTGCATGAAAATAGATCACTGTGTTATCGAATACCGGCAACAAGTGCCAATCAACGCCACTGGCTCGGTCATAGTGGAAATTCACGACAAGCGAATGAATGACAACGAATCATTACAAGCCTCGTGGACATTTCCAATTCGATGCAACATTGATCTGCATTATTTCTCGTCGTCATTCTTCTCTCTTAAAGACCCAATTCCTTGGAAGTTATATTACAAAGTCTCTGACACTAATGTTCATCAAAGAACACATTTCGCCAAATTCAAGGGAAAATTGAAACTGTCGACGGCTAAACACTCAGTGGATATCCCTTTCAAGGCACCAACGGTGAAGATCTTGTCGAAACAATTCACAGACAAAGACGTCGACTTTTCCCATGTGGCTTATGGGAATTGGGAAAGAAAATTAATCAGGAACGTTTCCACCTCCACAATAGGCCTAAACGGCCCAATCGAAATTAAGCCCGGTGAGTCATGGGCTTCAAGGAGTTCTTTAGGCCCAAACAATTCATATCCTGACTCGGAGGTGGGAAACGAACTACATCCATATAAGCAACTAAACAAATTGGGCTCTACAATATTAGATCCAGGCGACTCGGCATCAATTATTGGGGCCCAGAGGGCACAATCCAACATCACTTTGTCATTAGCCCAAATTAACGATATCGTTCGATCCACAGTCCAAGAGTGCATTAACCTGAACTGTACTCCATCTGAGCCCAAATCGTTGAAGTAA
Protein Sequence MESQLVIPPNAFNYIESQRDEYQLSHDLTEIVLQFPSTASQITARLSRSCMKIDHCVIEYRQQVPINATGSVIVEIHDKRMNDNESLQASWTFPIRCNIDLHYFSSSFFSLKDPIPWKLYYKVSDTNVHQRTHFAKFKGKLKLSTAKHSVDIPFKAPTVKILSKQFTDKDVDFSHVAYGNWERKLIRNVSTSTIGLNGPIEIKPGESWASRSSLGPNNSYPDSEVGNELHPYKQLNKLGSTILDPGDSASIIGAQRAQSNITLSLAQINDIVRSTVQECINLNCTPSEPKSLK

NCBI Accession YP_009508389.1
Location 194-967
Protein Name coat protein
Coding Region ATGCCTAAGCGGGACGCCCCATGGCGATTAATGGCGGGAACGTCCAAAGTTAGCCGCGGTGTCAGTTCATCCCCACGTGGTGGCATGGCGTTAATGAGTCCGATCGTGCGTAAGTTCAACAAGACCGCGGCTTGGGTTAATAGGCCCATGTACAAGAAGCCCAGAATATACAAGGTGCTCAGGACACCTGATGTGCCGTATGGCTGTGAGGGGCCTTGTAAGGTCCAGTCATACGAGTCCCGCCATGATGTATCGCATTCGGGTAAGGTAATTTGTATATCCGATGTGACACGGGGTAGTGGTATCACTCACCGTGTTGGTAAGCGTTTCTGCATAAAGTCTGTGTACATACTGGGGAAAATCTGGATGGATGATAACATCAAGCTTAAGAACCACACGAATAGTGTTATGTTCTGGTTGGTTAGGGACAGAAGACCGAACGGTACACCTATGGATTTCGGACATCTATTCAACATGTTCGATAACGAGCCGAGCACTGCTACGATTAAGAACGATCTTCGTGATCGTTTTCAAGTTATGCATAGGTTCTATGCCAAGGTGACAGGTGGTCAGTATGCCAGCAATGAACAGGCGTTAGTGAAGAGATTTTGGAAGGTCAACAATCACGTTGTGTATAACAACCAAGAAGCCGCTAGATACGAGAATCATACGGAGAACGCCCTCCTATTGTATATGGCGTGTACTCATGCATCGAATCCTGTATATGCAACCCTAAAAATTCGGATCTATTTTTATGATTCGATAACAAATTAA
Protein Sequence MPKRDAPWRLMAGTSKVSRGVSSSPRGGMALMSPIVRKFNKTAAWVNRPMYKKPRIYKVLRTPDVPYGCEGPCKVQSYESRHDVSHSGKVICISDVTRGSGITHRVGKRFCIKSVYILGKIWMDDNIKLKNHTNSVMFWLVRDRRPNGTPMDFGHLFNMFDNEPSTATIKNDLRDRFQVMHRFYAKVTGGQYASNEQALVKRFWKVNNHVVYNNQEAARYENHTENALLLYMACTHASNPVYATLKIRIYFYDSITN

NCBI Accession YP_009508390.1
Location 964-1362
Protein Name replication-enhancer protein
Coding Region ATGGATACACGCACAGGGGAATCCATCACTGCACCTCAGGCACAGAATGGCGTGTTTATCTGGGAAGTTCCAAATCCCCTTTATTTCAAGATCATCAACGTGGAGGATCTAATGTACACCAACACGAGGGTGTACCACGTCCAGATCAGGTTCAACCACAACCTGAGGAAAGCATTGGATCTCCACAAATGCTTCCTCAACTTCCAAGTCTGGACGACATCTCTGACAGCTTCTGGGAGGACTTATTTAAGTAGATTTACATACTTAGTCAATATGTATTTAGATCAGGTCGGAGTTATCTCCATTAATCTTGTAATTAGAGCTGTTCGTTTCGCAACAGATAGGGTGTATGTAAATCATGTACTCGAGAATCATTCAATAAAATATAAACTTTATTAA
Protein Sequence MDTRTGESITAPQAQNGVFIWEVPNPLYFKIINVEDLMYTNTRVYHVQIRFNHNLRKALDLHKCFLNFQVWTTSLTASGRTYLSRFTYLVNMYLDQVGVISINLVIRAVRFATDRVYVNHVLENHSIKYKLY

NCBI Accession YP_009508391.1
Location 1109-1498
Protein Name transactivating protein
Coding Region ATGCAAAATTCGTCTTCCTCAACTCCGCCCTCTATCAAACCGAGACACAGAGCCGCCAAGAAGAGGGCGATTAGACGACGTCGAATCGATCTGGTGTGCGGCTGTACCATATATCAACACATCGATTGCTACGGTCATGGATACACGCACAGGGGAATCCATCACTGCACCTCAGGCACAGAATGGCGTGTTTATCTGGGAAGTTCCAAATCCCCTTTATTTCAAGATCATCAACGTGGAGGATCTAATGTACACCAACACGAGGGTGTACCACGTCCAGATCAGGTTCAACCACAACCTGAGGAAAGCATTGGATCTCCACAAATGCTTCCTCAACTTCCAAGTCTGGACGACATCTCTGACAGCTTCTGGGAGGACTTATTTAAGTAG
Protein Sequence MQNSSSSTPPSIKPRHRAAKKRAIRRRRIDLVCGCTIYQHIDCYGHGYTHRGIHHCTSGTEWRVYLGSSKSPLFQDHQRGGSNVHQHEGVPRPDQVQPQPEESIGSPQMLPQLPSLDDISDSFWEDLFK

NCBI Accession YP_009508392.1
Location 1425-2498
Protein Name replication-associated protein
Coding Region ATGCCATCAGAACCACGTCGTTTTAGAGTAAATAGTAAGAATTTTTTCCTAACTTATCCCAAATGTTCCTTATCCAAAGAAGAGGCACTTTCCCAATTGCTAGGTCTGGAAACCCCAACAAATAAAAAATTCATTCGTGTGTCAAGAGAATTACACGAAGATGGGCAACCTCACCTCCATGTGCTCATTCAATTCGAGGGAAAATACAACTGCAAGAACAACAGGTTCTTCGATCTCGTCTCCTCAACTAGGTCAGCACATTTCCATCCGAACATTCAGGGAGCTAAGAGCTCCTCAGACGTTAAAACCTATGTGGAGAAAGACGGAGACTTCATTGATCATGGAGTTTTCCAAATCGACGGCAGATCTGCTAGAGGAGGTAAGCAATCTGCCAACGACACGTATGCCAAGGTCCTCAATTCAGGATCAATCTTGGAGGCCCTCAATATATTAAAGGAGGAACAACCCAAAGACTTCGTCCTTCAACACCACAATATCCGTTCCAATTTAGAACGTATTTTTCAAAAGGCTCCAGAACCGTTTGTTCCTCCGTTTCAACTCTCCTCATTCACTAACGTACCAGAGGAGATGCAAGAGTGGGCCGATGATTATTTTGGGAGAGTTGCCGCTGCGCGGCCTGTGAGACCTATTAGTTTGATTATCGAGGGTCATAGTCGAACGGGGAAGACATTGTGGGCTCGTGCCTTAGGGTCTCACAATTATCTTAGCGGTCATTTAGACTTTAATCCACGAGTTTATTGTAACGACGTTGATTATAACGTCATTGATGATATCACTCCCCAATATCTAAAAATGAAGCACTGGAAGGAACTCCTTGGGGCCCAAAGGGACTGGCAGTCAAATTGCAAATACGGAAAGCCAGTTCAAATTAAAGGTGGAGTTCCTTCAATCGTGCTGTGCAATCCAGGCGAAGGGTCCAGCTATAAAGATTTCCTCGAGAAAGAGGAAAACGCCGCACTCAAAAATTGGACTCTCCATAATGCAAAATTCGTCTTCCTCAACTCCGCCCTCTATCAAACCGAGACACAGAGCCGCCAAGAAGAGGGCGATTAG
Protein Sequence MPSEPRRFRVNSKNFFLTYPKCSLSKEEALSQLLGLETPTNKKFIRVSRELHEDGQPHLHVLIQFEGKYNCKNNRFFDLVSSTRSAHFHPNIQGAKSSSDVKTYVEKDGDFIDHGVFQIDGRSARGGKQSANDTYAKVLNSGSILEALNILKEEQPKDFVLQHHNIRSNLERIFQKAPEPFVPPFQLSSFTNVPEEMQEWADDYFGRVAAARPVRPISLIIEGHSRTGKTLWARALGSHNYLSGHLDFNPRVYCNDVDYNVIDDITPQYLKMKHWKELLGAQRDWQSNCKYGKPVQIKGGVPSIVLCNPGEGSSYKDFLEKEENAALKNWTLHNAKFVFLNSALYQTETQSRQEEGD

NCBI Accession YP_009508393.1
Location 2045-2338
Protein Name AC4 protein
Coding Region ATGGGCAACCTCACCTCCATGTGCTCATTCAATTCGAGGGAAAATACAACTGCAAGAACAACAGGTTCTTCGATCTCGTCTCCTCAACTAGGTCAGCACATTTCCATCCGAACATTCAGGGAGCTAAGAGCTCCTCAGACGTTAAAACCTATGTGGAGAAAGACGGAGACTTCATTGATCATGGAGTTTTCCAAATCGACGGCAGATCTGCTAGAGGAGGTAAGCAATCTGCCAACGACACGTATGCCAAGGTCCTCAATTCAGGATCAATCTTGGAGGCCCTCAATATATTAA
Protein Sequence MGNLTSMCSFNSRENTTARTTGSSISSPQLGQHISIRTFRELRAPQTLKPMWRKTETSLIMEFSKSTADLLEEVSNLPTTRMPRSSIQDQSWRPSIY

References More References in PubMed

1

Cnidoscolus mosaic leaf deformation virus: a novel begomovirus infecting euphorbiaceous plants in Brazil.

Melo AM, et al.  Arch Virol. 2016 Sep;161(9):2605-8. doi: 10.1007/s00705-016-2919-3. Epub 2016 Jun 8.

PMID: 27278930

2

High molecular diversity and divergent subpopulations of the begomovirus cnidoscolus mosaic leaf deformation virus associated with Cnidoscolus urens.

Mendes ALSF, et al.  Arch Virol. 2021 Dec;166(12):3289-3299. doi: 10.1007/s00705-021-05245-1. Epub 2021 Sep 23.

PMID: 34554304

3

Cnidoscolus mild mosaic virus: a new bipartite begomovirus isolated from Cnidoscolus urens in Brazil.

Chaves LFG, et al.  Arch Virol. 2022 Mar;167(3):1003-1005. doi: 10.1007/s00705-022-05367-0. Epub 2022 Feb 11.

PMID: 35147804