Sugarcane streak Reunion virus


Basic Information

Genus Mastrevirus
NCBI Assembly GCF_000843205.1
Release date 2015/2/12
Submitter Bigarre,L., Salah,M., Granier,M., Frutos,R., Thouvenel,J., Peterschmitt,M., Thouvenel,J.C.
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_004755
ACCGCGCTTTCTCATGCGAGCCCGTTAGGGCGAGCGGTCCCCTAGGCTTTAGGAGAGCTTGTTTTTCTCAGTCGGCCCCGATATTAAAGGGCCGCGTATGAATCGCACTATAAGTAGAGCCCTAGGTGCGATCTCTGCATGGATAGCCTTGAAGGAGCGTCCCCTGCTTTGCCCGCAGTAGCTTTGCCTCGTGTCCCCCGGGCAGCTCCGTCCGCTCCTGCGTTGCCGTGGAGCCGCGTTGGTGAAATAGCTATCTTTACCTTTGTTGCAGTGCTAGCGCTTTACTTACTTTGGGTTTGGGTGCTGAGAGATCTTGTCTTCGTTTTGAAGGCTCGACGAGGCGGATCTACGGAGGAGCTGCATTTTGGGCCCAGGGAGCGGGAGTCTGTCGCTTCTGCCGACAGTTCTCGTCCAGTCGCTGCTCCGTCGGCCCCTCCTGTAAGTGACGCTAGGCCTTTCTCGGTCTAGCTGCCGTGAGCATGCCTACTACCGCCGGGAAACGGAAGAGGACAGATGATGCCGCTTGGAGTAAGAGAGCTCGACCGAAGGCCGGGCGTACATCTGCCGCCCGGCCTGGTACTGCCGTTCGTCGGGTCCGTCCAGCTCTGCAGATCCAGACGCTCCAGGCGGCTGGCACGTCAATGATCACCGTTCCGTCGGGTGGTGTTTGTGATATCCTCGGGTCCTATTCACGAGGCTCTGACGAGTGCAATCGCCACACCAACGAGACTGTCACCTACAAGGTAGCTCTGGACTACCATTTCGTTGCTAGTGCAGCAGCCTGCAAGTATTCCAGTATTGGCACTGGCGTGGTGTGGTTGGTGTACGACGCACAGCCTCAGGGAAATTGTCCTACGGTGAAAGACATCTTCCCGCATCCTGACACTTTGAGCGCCTTCCCGTATACCTGGAAGGTCGGCCGAGAGGTGTGCCATCGGTTCGTGGTGAAGCGGCGGTGGACTTTCACGATGGAAGTCAATGGACGGATTGGATCTGATATGCCTCCTGCGACTGCCGTGTGGCCCCCGTGCCGGAAGAACATATACTTCCACAAGTTTGTCACCGGACTCGGCGTAAAAACGGAGTGGAAGAATACAACCGGCGGTGAAGTCGGAGACATTAAGAAGGGTGCCCTCTATATTGTAATTGCCCCAGGCAATGGACTCGATTTTACGGTGCATGGAAATGCCCGTTTGTACTTTAAGAGCGTTGGTAATCAGTGATTGCCAGCCAATGTAATAAAAACATTATTATTATGATTATCACGCCGCAGGCGTTACATTACATAGTCCGCAGATAGGCGGACAGGAAGCAAACACATACAATACTCGGCGGCCAGATCGTGGCGGCTAAGGGATAGCGCAGGAAAAAAACACACAAAAAAAACTGACATTATTGAAATTGGTCGGCGCTCAGACCCCGATAGGGGGATGGGCTGTAGCTGACACCGCGGGCCCGCCGAAGAAGCGCTCGCCTTCTTCCATTATGTAGACGACGCAGTTCTGATGAAAGTAGTCCAGCTGCCCTGGACTCATTACCTTCATCCAGTCTTCATCCTCGTTGGCAAGAACAATTGTGGAGATGCTTTTCTTGGCTACTCTCCGTTTCTTCCCATACTTGGGATTAACGACGTAGTTCTCTTGGCAACCAATCAGTTGCTTCCAGCAAGGACAGAACTTGAAGGGGATGTCGTCAATGACGTTGTAGACTGCGTCCTCGTCGTAGCAGGACCAGTCGACGTTGTTTTGCCAGTAATTATGTCTTCCCAGGCTACGGGCCCAAGTAGATTTTCCAGTTCTTGTTGGGCCGAGGATGTAGAGGCTAAGCTTTCTTGTACCTGTATTGTTCTGGATGTAGAAGACATCCATTCTAGGTCAGAGGATGCCTCTTCCAGGCTTAAGCAATGTGGGTTACAGAGCATGTATGCTTCAGGACTAACCTGAAACAGGTTGGGTTGCACCCAGTTGTCAATGGTGGTTGGGTCCCTCAGAAGTGGCGTGGTAGTAGGATGAGGACTGGTGTACTCTTCCACAGTATCTGGGAATAGCTTAGAAGCTGAGTATTCAAAGTATTGCAGTTTCGTAGCCCAGTCGTATGGTAATGCCTTCTGAAGCATGGAAAGGTACTCTTCCTTAGAGGTGGAGTGCTCGATGATATCTCTAACGATATCATCCTTGGAGGGTTTGGAATTCTTGCTCTCAGAGGAAGAGGATACAAAGCATTGTTTGCGTGGAATAAATGTACCTTTCTCCCATTTAGCGATTGGATTTTTCAGTATGTATTCCCTGACTTTGTTGGCACTCTTTGCACTCTGAATGTTAGGGTGGAAACTCTCAATGTCGAAGAACCCTTGGTTCGTCGTTTGTACAGGCCTGACGCTCTGGACTAAGGCATGGAGGTGCCATTCTCCATCTGCGTGTGCTTCCCTGCTCACTAGAATGTACGCCGGACTCCAGTGACTAATGAGCTGCCATAGTATCAGACCCACTGCCTCTGGGTCCAGTCTGCAGCGAGAGTAAGTGAGGAAGGTGTTGGCATTCCTATGCTTGAATGGCCTGGAGGCTACGGTGGAGTCCTCCTGTGAAGGCATGGAGTCTGATTTGGGAGCTCTCCAACTCTACTACAACAGGTTTTGCGAATCGAAATCCGACCTCCCTCGGCTTTATAGCCGACGTAAGTGGGCTGGGCCCAAAGTTTTTTGGGCCGCAATGAGAAAGCGCAAAACCAATAATATT

Gene Information

NCBI Accession NP_840050.1
Location 139-468
Gene Name V1
Protein Name putative movement protein V1
Coding Region ATGGATAGCCTTGAAGGAGCGTCCCCTGCTTTGCCCGCAGTAGCTTTGCCTCGTGTCCCCCGGGCAGCTCCGTCCGCTCCTGCGTTGCCGTGGAGCCGCGTTGGTGAAATAGCTATCTTTACCTTTGTTGCAGTGCTAGCGCTTTACTTACTTTGGGTTTGGGTGCTGAGAGATCTTGTCTTCGTTTTGAAGGCTCGACGAGGCGGATCTACGGAGGAGCTGCATTTTGGGCCCAGGGAGCGGGAGTCTGTCGCTTCTGCCGACAGTTCTCGTCCAGTCGCTGCTCCGTCGGCCCCTCCTGTAAGTGACGCTAGGCCTTTCTCGGTCTAG
Protein Sequence MDSLEGASPALPAVALPRVPRAAPSAPALPWSRVGEIAIFTFVAVLALYLLWVWVLRDLVFVLKARRGGSTEELHFGPRERESVASADSSRPVAAPSAPPVSDARPFSV

NCBI Accession NP_840051.1
Location 480-1223
Gene Name V2
Protein Name coat protein
Coding Region ATGCCTACTACCGCCGGGAAACGGAAGAGGACAGATGATGCCGCTTGGAGTAAGAGAGCTCGACCGAAGGCCGGGCGTACATCTGCCGCCCGGCCTGGTACTGCCGTTCGTCGGGTCCGTCCAGCTCTGCAGATCCAGACGCTCCAGGCGGCTGGCACGTCAATGATCACCGTTCCGTCGGGTGGTGTTTGTGATATCCTCGGGTCCTATTCACGAGGCTCTGACGAGTGCAATCGCCACACCAACGAGACTGTCACCTACAAGGTAGCTCTGGACTACCATTTCGTTGCTAGTGCAGCAGCCTGCAAGTATTCCAGTATTGGCACTGGCGTGGTGTGGTTGGTGTACGACGCACAGCCTCAGGGAAATTGTCCTACGGTGAAAGACATCTTCCCGCATCCTGACACTTTGAGCGCCTTCCCGTATACCTGGAAGGTCGGCCGAGAGGTGTGCCATCGGTTCGTGGTGAAGCGGCGGTGGACTTTCACGATGGAAGTCAATGGACGGATTGGATCTGATATGCCTCCTGCGACTGCCGTGTGGCCCCCGTGCCGGAAGAACATATACTTCCACAAGTTTGTCACCGGACTCGGCGTAAAAACGGAGTGGAAGAATACAACCGGCGGTGAAGTCGGAGACATTAAGAAGGGTGCCCTCTATATTGTAATTGCCCCAGGCAATGGACTCGATTTTACGGTGCATGGAAATGCCCGTTTGTACTTTAAGAGCGTTGGTAATCAGTGA
Protein Sequence MPTTAGKRKRTDDAAWSKRARPKAGRTSAARPGTAVRRVRPALQIQTLQAAGTSMITVPSGGVCDILGSYSRGSDECNRHTNETVTYKVALDYHFVASAAACKYSSIGTGVVWLVYDAQPQGNCPTVKDIFPHPDTLSAFPYTWKVGREVCHRFVVKRRWTFTMEVNGRIGSDMPPATAVWPPCRKNIYFHKFVTGLGVKTEWKNTTGGEVGDIKKGALYIVIAPGNGLDFTVHGNARLYFKSVGNQ

NCBI Accession NP_840052.1
Location 1413->1847
Gene Name C2
Protein Name RepB
Coding Region AACAATACAGGTACAAGAAAGCTTAGCCTCTACATCCTCGGCCCAACAAGAACTGGAAAATCTACTTGGGCCCGTAGCCTGGGAAGACATAATTACTGGCAAAACAACGTCGACTGGTCCTGCTACGACGAGGACGCAGTCTACAACGTCATTGACGACATCCCCTTCAAGTTCTGTCCTTGCTGGAAGCAACTGATTGGTTGCCAAGAGAACTACGTCGTTAATCCCAAGTATGGGAAGAAACGGAGAGTAGCCAAGAAAAGCATCTCCACAATTGTTCTTGCCAACGAGGATGAAGACTGGATGAAGGTAATGAGTCCAGGGCAGCTGGACTACTTTCATCAGAACTGCGTCGTCTACATAATGGAAGAAGGCGAGCGCTTCTTCGGCGGGCCCGCGGTGTCAGCTACAGCCCATCCCCCTATCGGGGTCTGA
Protein Sequence NNTGTRKLSLYILGPTRTGKSTWARSLGRHNYWQNNVDWSCYDEDAVYNVIDDIPFKFCPCWKQLIGCQENYVVNPKYGKKRRVAKKSISTIVLANEDEDWMKVMSPGQLDYFHQNCVVYIMEEGERFFGGPAVSATAHPPIGV

NCBI Accession NP_840053.1
Location 1652-2590
Gene Name C1
Protein Name RepA
Coding Region ATGCCTTCACAGGAGGACTCCACCGTAGCCTCCAGGCCATTCAAGCATAGGAATGCCAACACCTTCCTCACTTACTCTCGCTGCAGACTGGACCCAGAGGCAGTGGGTCTGATACTATGGCAGCTCATTAGTCACTGGAGTCCGGCGTACATTCTAGTGAGCAGGGAAGCACACGCAGATGGAGAATGGCACCTCCATGCCTTAGTCCAGAGCGTCAGGCCTGTACAAACGACGAACCAAGGGTTCTTCGACATTGAGAGTTTCCACCCTAACATTCAGAGTGCAAAGAGTGCCAACAAAGTCAGGGAATACATACTGAAAAATCCAATCGCTAAATGGGAGAAAGGTACATTTATTCCACGCAAACAATGCTTTGTATCCTCTTCCTCTGAGAGCAAGAATTCCAAACCCTCCAAGGATGATATCGTTAGAGATATCATCGAGCACTCCACCTCTAAGGAAGAGTACCTTTCCATGCTTCAGAAGGCATTACCATACGACTGGGCTACGAAACTGCAATACTTTGAATACTCAGCTTCTAAGCTATTCCCAGATACTGTGGAAGAGTACACCAGTCCTCATCCTACTACCACGCCACTTCTGAGGGACCCAACCACCATTGACAACTGGGTGCAACCCAACCTGTTTCAGGTTAGTCCTGAAGCATACATGCTCTGTAACCCACATTGCTTAAGCCTGGAAGAGGCATCCTCTGACCTAGAATGGATGTCTTCTACATCCAGAACAATACAGGTACAAGAAAGCTTAGCCTCTACATCCTCGGCCCAACAAGAACTGGAAAATCTACTTGGGCCCGTAGCCTGGGAAGACATAATTACTGGCAAAACAACGTCGACTGGTCCTGCTACGACGAGGACGCAGTCTACAACGTCATTGACGACATCCCCTTCAAGTTCTGTCCTTGCTGGAAGCAACTGA
Protein Sequence MPSQEDSTVASRPFKHRNANTFLTYSRCRLDPEAVGLILWQLISHWSPAYILVSREAHADGEWHLHALVQSVRPVQTTNQGFFDIESFHPNIQSAKSANKVREYILKNPIAKWEKGTFIPRKQCFVSSSSESKNSKPSKDDIVRDIIEHSTSKEEYLSMLQKALPYDWATKLQYFEYSASKLFPDTVEEYTSPHPTTTPLLRDPTTIDNWVQPNLFQVSPEAYMLCNPHCLSLEEASSDLEWMSSTSRTIQVQESLASTSSAQQELENLLGPVAWEDIITGKTTSTGPATTRTQSTTSLTTSPSSSVLAGSN

References More References in PubMed

1

First Report of Maize streak virus Field Infection of Sugarcane in South Africa.

van Antwerpen T, et al.  Plant Dis. 2008 Jun;92(6):982. doi: 10.1094/PDIS-92-6-0982A.

PMID: 30769738

2

Novel sugarcane streak and Sugarcane streak Réunion mastreviruses from southern Africa and La Réunion.

Shepherd DN, et al.  Arch Virol. 2008;153(3):605-9. doi: 10.1007/s00705-007-0016-3. Epub 2008 Jan 4.

PMID: 18175043

3

Occurrence of a novel mastrevirus in sugarcane germplasm collections in Florida, Guadeloupe and Réunion.

Boukari W, et al.  Virol J. 2017 Jul 28;14(1):146. doi: 10.1186/s12985-017-0810-9.

PMID: 28754134

4

Nucleotide sequence evidence for three distinct sugarcane streak mastreviruses.

Bigarré L, et al.  Arch Virol. 1999;144(12):2331-44. doi: 10.1007/s007050050647.

PMID: 10664387

5

A high degree of African streak virus diversity within Nigerian maize fields includes a new mastrevirus from Axonopus compressus.

Oluwafemi S, et al.  Arch Virol. 2014 Oct;159(10):2765-70. doi: 10.1007/s00705-014-2090-7. Epub 2014 May 6.

PMID: 24796552

6

Molecular diversity, geographic distribution and host range of monocot-infecting mastreviruses in Africa and surrounding islands.

Kraberger S, et al.  Virus Res. 2017 Jun 15;238:171-178. doi: 10.1016/j.virusres.2017.07.001. Epub 2017 Jul 4.

PMID: 28687345

7

Experimental evidence indicating that mastreviruses probably did not co-diverge with their hosts.

Harkins GW, et al.  Virol J. 2009 Jul 16;6:104. doi: 10.1186/1743-422X-6-104.

PMID: 19607673