Abutilon mosaic Bolivia virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_000890575.1
Isolate Bolivia
Release date 2015/2/22
Submitter Wyant,P.S., Gotthardt,D., Schafer,B., Krenz,B., Jeske,H.
Host
Vector
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_015045
ACCGGATGGCCGCGCGCCCGCCCCCACGTGGAGCCCTGGTGACCGTTCGATCCCCCCCCTTTGGTGCGCTGGTGCCCGTACAATACCAATTGAGCGCATTTTTGGAGTCCGCGAATTTAGTTGAGCGTAATTTTGAGATCCGCCCCGCGGACCCGTTCGAACTTTAATTTGAATTAAAGTATTACCGTTGGGAAGCGTCCAATCACTTTTGTCCTGTCGCGCTTAGATATGCGTTAAAGTCCTTGGTGCACAAGTTTAGCCGTTATATAAAGTTTAACCTATGTTTAACCGTCTTGCTTTAATTCGAAATGCCTAAGCGCGATGCCCCGTGGCGCTCTATGGCGGGAACCTCAAAGGTTAGCCGCGCTAACAATTTTTCCCCTCGTGGAGGTATGGTGTCCAAGCCCAACAAGGCCGCTCTATGGGTTAATAGGCCCATGTACAGGAAGCCCAGAATATATCGTACTCTAAGATCGCCCGACGTTCCCAAAGGCTGTGAAGGGCCTTGTAAGGTCCAATCCTTCGAGCAGCGCCACGATATCTCCCATGTCGGCAAGGTAATATGCGTGTCCGACGTTACCCGTGGTAACGGTATTACCCACCGTGTTGGGAAACGTTTTTGCGTTAAGTCCGTGTACATTCTAGGGAAGATATGGATGGACGAGAATATCAAGTTGAAGAACCACACGAACAGCGTCATGTTTTGGTTAGTTAGGGACCGTAGACCGTATGGAACGCCAATGGACTTTGGCCAGGTGTTCAACATGTTCGACAACGAGCCCAGTACTGCTACTGTCAAGAACGATATTCGCGATCGTTTTCAAGTTTTGCACAAGTTCTACGCCAAGGTTACAGGTGGACAATATGCAAGCAATGAACAGGCTCTCGTACGGCGTTTTTGGAGGATCAACAACTACGTGGTGTATAACCATCAAGATGCAGCGAAGTATGAGAATCACACCGAGAACGCCGTATTACTTTACATGGCATGTACGCATGCATCTAACCCCGTGTACGCAACGCTTAAGATACGAATCTATTTTTATGATTCGTTAATGAATTAATAAAGTTTAAATTTTATTGCATGATCTTCAAGTACATAGTTTACATAACGTCTGGCCGTTGCGTAACGCACAGCTCTAATTACATTGTTAATGGTAATAACTCCTAATTCGTCTAAGTACATGGTAACTATGGATTTAAACCTACTTAAATAAGTCGTCCCAGAAGGTTGAATCGATGTCGTCCAGACTTGGAAGTTCAGGAAGCATTTGTGGAGATCCAATGCTTTCCTCAGGTTGTGGTTGAACCGTATTTGTATGTGGTATACCCTGTTGTTGGTGTACAGCTGGTCCTCTACTCTGTACATCTTGAAATAAAGGGGATTGTCTACCTCCCAGATATAGACGCCATTCTCTGCCTGAGGCGCAGTGATGAGTTCCCCGGTGCGTGAATCCATGATTGCTGCAGTTAAGGTGGACGTATATGGAGCAGCCGCAGTTAAGATCAATTCGTCTACGGCGAGTTACCCGTCTCTTCGCCGCCCTGTGATGAGGCTTGATAGAGGGGGGAGTTGAGGAAGACGAATTTCGCATTATGTAGAGTCCAGGCTTTGAGAGCTGAGTTTTCAGCTTTGTCGAGGAAATCTTTATAACTAGATCCCTCGCCTGGATTGCAGAGCACGATTGATGGAAGCCCGCCTTTAATTTGAACTGGCTTTCCGTATTTGCAATTTGATTGCCAGTCCTTTTGAGCCCCAATCAATTCTTTCCAGTGCTTTAGCTTTAGATAATGCGGGCTTACATCATCAATGACGTTGTACTCCACTAAGTTTGAATAAACCCTAGAATTGAAATCTAGGTGCCCGCTAAGATAATTATGTGGGCCTAACGCACGAGCCCACATTGTCTTCCCCGTCCGACTATCGCCCTCGATGATCAAACTTATGGGCCTAACAGGCCGCGCAGCGGCACCTCTCCCGAAATACTCGTCAGCCCATTCTTGCATCTCGTCAGGAACATTAGTGAAGGAGGAGAGGTGAAACGGAGAAGCCCAAGGCTCCGGAGCCTTAGAGAATATCCTGTCCAGGTTACTGGACAGATTGTGATACTGAAATAAGAACTTTTCCGGTAACTTCTCCTTTATTATTTGCATCGCTGCTTCTTTGGTCGATGCATTTAACGCCTCTGCTGCAGCGTCATTAGCTGTTTGCTTACCTCCTCTAGCAGATCTCCCGTCGATCTGGAATTCTCCCCATACAAGAATATCCCCGTCTTTGTCGACGTAGGACTTGACGTCGGAGCTGGACCTAGCTCCTTGATAGTTCCCATGGAACTGTGTTGAACTATGTGGGGAGACCAAGTCGAAGAATCTTTTATTTTGGCAGTTGTATTTGCCTTCGAACTGGAGCAACACATGTAAATGAGGCTGCCCATCTTCGTGGAGCTCTCGACAGATCTTGACGTATTTCTTATTTGTTGGGGTTTGAAGGTTTAGTAGTTGGGAAAGTACCTCCTCTTTGGATAGTGAGCATTTGGGATAAGTGAGGAAATAATTCTTGGCATTTATTTGAAAAGGCTTGACCCGTGGCATTATTGTAAATAAGAGGCTCACTACCGGTAGTAGCTCTTCTCAAAACTCTATATGAATCGGTAGTAAGGTAGTGTATTTATAGAAGTTCTCTCAAGGACACGTGGCGGCCATCCGACTATAATATT

NC_015048
ACCGGATGGCCGCGCGCCCGCCCCCCCACGTGGAGCCCTGGTGACCGTTCGATCCCCCCCCCTTGGTGCGCTGGTGCCCGTACAATACCAATTGAGCGCATTTTTGAAGTCCGCGAATTTAGTTGAGCGCAATTTTGAGATCCGCCCCGCGGACCCGTTCGACCTTTAATTTGAATTAAAGTATTTTCGTTAAAGTCGCGCGATATTTTGTCAGAACGCTTTGTGTTTGTACCGTTAGATATCTTTAAGGAATGATCGCCCGGCTGAAATTAAAATAGGAATTAAAGTGGATCGTTCTGACAATATGACCCATAGATACAATGATTTTTGTTTTTGTCATTGTACTTAATTTTGAACATCGACCAATTAAATAAGCTCTATATTGTTAAGATAAGTAATACATCTGAATGGGAATTTATATTTAAATTCAATTATGTTGAGCTTGCCACTGCGTCGATGTACATTGAATAGCTACGCTTGATATATTCTTAATAGGCAGTACTGAACATGTATCCTACTAAGTTTAGACGTGGTTGGTCGTCTACTAAACGAAGAAGCTATTCACGATTTCCCCAGTCCAGACGTTCTATTTCTGTCAAGCGTACTGATGGGAAACGTCGTCCTAGTAGTACCAAGAAAACTCCAGTTGAAGGTCAAATGGTGGAACAACGCATACATGAAAACCAGTTTGGGCCCGAATTTGTTATGGGCCAAAATTCAGCCCTTTCGACTTTTATCAACTACCCTGTACTCGGTAAAACCCTCCCTAATCGATCCCGTGCATATATCAAGTTAAAACGACTTCGTTTTAAAGGTACTGTCAAGATTGAACGTGTTCATGCTGACGTGAACATGGAGGGTGCACCCCCAAAGATCGAAGGGGTCTTTTCATTAGTCGTTGTGGTTGATCGTAAACCCCACTTGAGCCCGACAGGATGTCTTCATACATTTGATGAGTTATTCGGTGCAAGGATCAATAGCCATGGTAATTTAGACATTACTCCCTCTCTGAAAGACCGTTTCTACATACGTCACGTTCTGAAACGTGTTCTGTCCGTGGAGAAGGATACGATGATGGTTGACCTTGAAGGAACGACATCCCTATCTAACAGGCGTTTTAATTGTTGGGCTTCGTTTAATGACCTTGATCGGGAGTCATGTAATGGTGTTTATGCAAATATAAGCAAGAACGCCCTGTTAGTTTATTATTGTTGGATGTCGGATATCCCGTCTAAGGCATCGACATTTGTATCTTTTGACCTTGATTATATCGGATAATAATAAGAATTGCTATTATGTTAAGTCAACTGCAAGTAATGATAAGATAAGAAAATAAACAGCGTTTATTTCAATGATTTTGGTGCTGACGGAGTACAATTATTGTTAATACACTCTTGGACCGTCGTCCTCACAAGTTCACTCAATTGTGCCACTGACATTGTTATATTTGACTGTGCCCTCTGGGCCCCGACAATTGAAGCGGAGTCTCCTGGGTCTAGGATGGTGGTACCGAGTCTGTTAAGTTCCCTATACGGATGTGTGGCGTCCCCCACATCAGAATCCGCATCGTTGTGTCCTATGGTACTACGAGAGGCCCATGATTCGCCTGGTCTTAATTCAAGTGGGCTTGGAAGCCCAAATCTTAATGTTGAGGCGGATCTGATAAGCTTCCTCTCCCACCTTCCATAGTCGACGTGCGAGAAATCGACATCTTTGTCGGTGAACTGTTTAGATAAGATCTTAACGGTCGGTGCCCGGAACGGGATATCTACGGAATGTTTTGCCGTCGACAGTTTCAGCTTCCCCTTGAATTTTGCGAAATGGGTCCTCTGATGAACGTTGGTGTCGGAAACTCTGTAATACAGTTTCCATGGAATTGGGTCTTTAAGTGAGAAGAAAGATGATGAGAAATAATGGAGATCTATGTTACATCTGATGGGAAATGTCCACGAAGCTTGTAAGGATTCATTGTCAGTCATCCTCTTGTCGTGGATCTCCATAATTACAGACCCCGTCGCGTTAATTGGAACTTGCTGTCTGTATTCGATGACGCAATGGTCGATTTTCATGCAGCTACGACTGAGTCTAGCTGTTAATTGAGATGCCGTCGACGGAAATTGCAAAATAATCTCCGTTAAGTCATGCGAAAGCTGATATTCGTCACGATGCGATTCTATATAATTAAAGGCGTTAGGAGGATTAACCAGCTGAGAAGATTCCATTGAAAATTATGGGAGCGCAGCGACAACGACGAGGTTAATGAAATGGGGAAAGAGAGTATATGAGGAAGAAAATTTACTAATTGGAATAAGAAAGTAATGCAAGATGAAGAGGAACTCTGTTTTAGAAGGAGAATAAATAATAGTAGTGAAGGGATGCTGAGAACTATCAATTGGGTGTTGTGCTTATATAGAAAGGAAAAGACTTGTTAAGTTAATTAGTTTAAGGAATAATTAAATTAAGTTAAGCTGTCATTATTTGGTAGATGAGTGTGTTTTGATGTTGATAAGCACAACTTACCTATAGTTAAGACAATGAAAAGGAAGTTCGGTGGCATTCTTGTAAATAAGAGCCTCACTACCGGTAGTAGCTCCTCTCAAAACTCTATATGAATCGGTAGTAAGGTAGTGTATTTATAGAAGTTCTCTCAAGGACACGTGGCGGCCATCCGACTATAATATT

Gene Information

NCBI Accession YP_004207819.1
Location 309-1064
Gene Name AV1
Protein Name coat protein
Coding Region ATGCCTAAGCGCGATGCCCCGTGGCGCTCTATGGCGGGAACCTCAAAGGTTAGCCGCGCTAACAATTTTTCCCCTCGTGGAGGTATGGTGTCCAAGCCCAACAAGGCCGCTCTATGGGTTAATAGGCCCATGTACAGGAAGCCCAGAATATATCGTACTCTAAGATCGCCCGACGTTCCCAAAGGCTGTGAAGGGCCTTGTAAGGTCCAATCCTTCGAGCAGCGCCACGATATCTCCCATGTCGGCAAGGTAATATGCGTGTCCGACGTTACCCGTGGTAACGGTATTACCCACCGTGTTGGGAAACGTTTTTGCGTTAAGTCCGTGTACATTCTAGGGAAGATATGGATGGACGAGAATATCAAGTTGAAGAACCACACGAACAGCGTCATGTTTTGGTTAGTTAGGGACCGTAGACCGTATGGAACGCCAATGGACTTTGGCCAGGTGTTCAACATGTTCGACAACGAGCCCAGTACTGCTACTGTCAAGAACGATATTCGCGATCGTTTTCAAGTTTTGCACAAGTTCTACGCCAAGGTTACAGGTGGACAATATGCAAGCAATGAACAGGCTCTCGTACGGCGTTTTTGGAGGATCAACAACTACGTGGTGTATAACCATCAAGATGCAGCGAAGTATGAGAATCACACCGAGAACGCCGTATTACTTTACATGGCATGTACGCATGCATCTAACCCCGTGTACGCAACGCTTAAGATACGAATCTATTTTTATGATTCGTTAATGAATTAA
Protein Sequence MPKRDAPWRSMAGTSKVSRANNFSPRGGMVSKPNKAALWVNRPMYRKPRIYRTLRSPDVPKGCEGPCKVQSFEQRHDISHVGKVICVSDVTRGNGITHRVGKRFCVKSVYILGKIWMDENIKLKNHTNSVMFWLVRDRRPYGTPMDFGQVFNMFDNEPSTATVKNDIRDRFQVLHKFYAKVTGGQYASNEQALVRRFWRINNYVVYNHQDAAKYENHTENAVLLYMACTHASNPVYATLKIRIYFYDSLMN

NCBI Accession YP_004207820.1
Location 1061-1459
Gene Name AC3
Protein Name replication enhancer
Coding Region ATGGATTCACGCACCGGGGAACTCATCACTGCGCCTCAGGCAGAGAATGGCGTCTATATCTGGGAGGTAGACAATCCCCTTTATTTCAAGATGTACAGAGTAGAGGACCAGCTGTACACCAACAACAGGGTATACCACATACAAATACGGTTCAACCACAACCTGAGGAAAGCATTGGATCTCCACAAATGCTTCCTGAACTTCCAAGTCTGGACGACATCGATTCAACCTTCTGGGACGACTTATTTAAGTAGGTTTAAATCCATAGTTACCATGTACTTAGACGAATTAGGAGTTATTACCATTAACAATGTAATTAGAGCTGTGCGTTACGCAACGGCCAGACGTTATGTAAACTATGTACTTGAAGATCATGCAATAAAATTTAAACTTTATTAA
Protein Sequence MDSRTGELITAPQAENGVYIWEVDNPLYFKMYRVEDQLYTNNRVYHIQIRFNHNLRKALDLHKCFLNFQVWTTSIQPSGTTYLSRFKSIVTMYLDELGVITINNVIRAVRYATARRYVNYVLEDHAIKFKLY

NCBI Accession YP_004207821.1
Location 1206-1595
Gene Name AC2
Protein Name transcriptional regulator
Coding Region ATGCGAAATTCGTCTTCCTCAACTCCCCCCTCTATCAAGCCTCATCACAGGGCGGCGAAGAGACGGGTAACTCGCCGTAGACGAATTGATCTTAACTGCGGCTGCTCCATATACGTCCACCTTAACTGCAGCAATCATGGATTCACGCACCGGGGAACTCATCACTGCGCCTCAGGCAGAGAATGGCGTCTATATCTGGGAGGTAGACAATCCCCTTTATTTCAAGATGTACAGAGTAGAGGACCAGCTGTACACCAACAACAGGGTATACCACATACAAATACGGTTCAACCACAACCTGAGGAAAGCATTGGATCTCCACAAATGCTTCCTGAACTTCCAAGTCTGGACGACATCGATTCAACCTTCTGGGACGACTTATTTAAGTAG
Protein Sequence MRNSSSSTPPSIKPHHRAAKRRVTRRRRIDLNCGCSIYVHLNCSNHGFTHRGTHHCASGREWRLYLGGRQSPLFQDVQSRGPAVHQQQGIPHTNTVQPQPEESIGSPQMLPELPSLDDIDSTFWDDLFK

NCBI Accession YP_004207822.1
Location 1516-2592
Gene Name AC1
Protein Name replication-associated protein
Coding Region ATGCCACGGGTCAAGCCTTTTCAAATAAATGCCAAGAATTATTTCCTCACTTATCCCAAATGCTCACTATCCAAAGAGGAGGTACTTTCCCAACTACTAAACCTTCAAACCCCAACAAATAAGAAATACGTCAAGATCTGTCGAGAGCTCCACGAAGATGGGCAGCCTCATTTACATGTGTTGCTCCAGTTCGAAGGCAAATACAACTGCCAAAATAAAAGATTCTTCGACTTGGTCTCCCCACATAGTTCAACACAGTTCCATGGGAACTATCAAGGAGCTAGGTCCAGCTCCGACGTCAAGTCCTACGTCGACAAAGACGGGGATATTCTTGTATGGGGAGAATTCCAGATCGACGGGAGATCTGCTAGAGGAGGTAAGCAAACAGCTAATGACGCTGCAGCAGAGGCGTTAAATGCATCGACCAAAGAAGCAGCGATGCAAATAATAAAGGAGAAGTTACCGGAAAAGTTCTTATTTCAGTATCACAATCTGTCCAGTAACCTGGACAGGATATTCTCTAAGGCTCCGGAGCCTTGGGCTTCTCCGTTTCACCTCTCCTCCTTCACTAATGTTCCTGACGAGATGCAAGAATGGGCTGACGAGTATTTCGGGAGAGGTGCCGCTGCGCGGCCTGTTAGGCCCATAAGTTTGATCATCGAGGGCGATAGTCGGACGGGGAAGACAATGTGGGCTCGTGCGTTAGGCCCACATAATTATCTTAGCGGGCACCTAGATTTCAATTCTAGGGTTTATTCAAACTTAGTGGAGTACAACGTCATTGATGATGTAAGCCCGCATTATCTAAAGCTAAAGCACTGGAAAGAATTGATTGGGGCTCAAAAGGACTGGCAATCAAATTGCAAATACGGAAAGCCAGTTCAAATTAAAGGCGGGCTTCCATCAATCGTGCTCTGCAATCCAGGCGAGGGATCTAGTTATAAAGATTTCCTCGACAAAGCTGAAAACTCAGCTCTCAAAGCCTGGACTCTACATAATGCGAAATTCGTCTTCCTCAACTCCCCCCTCTATCAAGCCTCATCACAGGGCGGCGAAGAGACGGGTAACTCGCCGTAG
Protein Sequence MPRVKPFQINAKNYFLTYPKCSLSKEEVLSQLLNLQTPTNKKYVKICRELHEDGQPHLHVLLQFEGKYNCQNKRFFDLVSPHSSTQFHGNYQGARSSSDVKSYVDKDGDILVWGEFQIDGRSARGGKQTANDAAAEALNASTKEAAMQIIKEKLPEKFLFQYHNLSSNLDRIFSKAPEPWASPFHLSSFTNVPDEMQEWADEYFGRGAAARPVRPISLIIEGDSRTGKTMWARALGPHNYLSGHLDFNSRVYSNLVEYNVIDDVSPHYLKLKHWKELIGAQKDWQSNCKYGKPVQIKGGLPSIVLCNPGEGSSYKDFLDKAENSALKAWTLHNAKFVFLNSPLYQASSQGGEETGNSP

NCBI Accession YP_004207823.1
Location 2178-2435
Gene Name AC4
Protein Name AC4 protein
Coding Region ATGGGCAGCCTCATTTACATGTGTTGCTCCAGTTCGAAGGCAAATACAACTGCCAAAATAAAAGATTCTTCGACTTGGTCTCCCCACATAGTTCAACACAGTTCCATGGGAACTATCAAGGAGCTAGGTCCAGCTCCGACGTCAAGTCCTACGTCGACAAAGACGGGGATATTCTTGTATGGGGAGAATTCCAGATCGACGGGAGATCTGCTAGAGGAGGTAAGCAAACAGCTAATGACGCTGCAGCAGAGGCGTTAA
Protein Sequence MGSLIYMCCSSSKANTTAKIKDSSTWSPHIVQHSSMGTIKELGPAPTSSPTSTKTGIFLYGENSRSTGDLLEEVSKQLMTLQQRR

NCBI Accession YP_004207831.1
Location 508-1278
Gene Name BV1
Protein Name nuclear shuttle protein
Coding Region ATGTATCCTACTAAGTTTAGACGTGGTTGGTCGTCTACTAAACGAAGAAGCTATTCACGATTTCCCCAGTCCAGACGTTCTATTTCTGTCAAGCGTACTGATGGGAAACGTCGTCCTAGTAGTACCAAGAAAACTCCAGTTGAAGGTCAAATGGTGGAACAACGCATACATGAAAACCAGTTTGGGCCCGAATTTGTTATGGGCCAAAATTCAGCCCTTTCGACTTTTATCAACTACCCTGTACTCGGTAAAACCCTCCCTAATCGATCCCGTGCATATATCAAGTTAAAACGACTTCGTTTTAAAGGTACTGTCAAGATTGAACGTGTTCATGCTGACGTGAACATGGAGGGTGCACCCCCAAAGATCGAAGGGGTCTTTTCATTAGTCGTTGTGGTTGATCGTAAACCCCACTTGAGCCCGACAGGATGTCTTCATACATTTGATGAGTTATTCGGTGCAAGGATCAATAGCCATGGTAATTTAGACATTACTCCCTCTCTGAAAGACCGTTTCTACATACGTCACGTTCTGAAACGTGTTCTGTCCGTGGAGAAGGATACGATGATGGTTGACCTTGAAGGAACGACATCCCTATCTAACAGGCGTTTTAATTGTTGGGCTTCGTTTAATGACCTTGATCGGGAGTCATGTAATGGTGTTTATGCAAATATAAGCAAGAACGCCCTGTTAGTTTATTATTGTTGGATGTCGGATATCCCGTCTAAGGCATCGACATTTGTATCTTTTGACCTTGATTATATCGGATAA
Protein Sequence MYPTKFRRGWSSTKRRSYSRFPQSRRSISVKRTDGKRRPSSTKKTPVEGQMVEQRIHENQFGPEFVMGQNSALSTFINYPVLGKTLPNRSRAYIKLKRLRFKGTVKIERVHADVNMEGAPPKIEGVFSLVVVVDRKPHLSPTGCLHTFDELFGARINSHGNLDITPSLKDRFYIRHVLKRVLSVEKDTMMVDLEGTTSLSNRRFNCWASFNDLDRESCNGVYANISKNALLVYYCWMSDIPSKASTFVSFDLDYIG

NCBI Accession YP_004207832.1
Location 1344-2222
Gene Name BC1
Protein Name movement protein
Coding Region ATGGAATCTTCTCAGCTGGTTAATCCTCCTAACGCCTTTAATTATATAGAATCGCATCGTGACGAATATCAGCTTTCGCATGACTTAACGGAGATTATTTTGCAATTTCCGTCGACGGCATCTCAATTAACAGCTAGACTCAGTCGTAGCTGCATGAAAATCGACCATTGCGTCATCGAATACAGACAGCAAGTTCCAATTAACGCGACGGGGTCTGTAATTATGGAGATCCACGACAAGAGGATGACTGACAATGAATCCTTACAAGCTTCGTGGACATTTCCCATCAGATGTAACATAGATCTCCATTATTTCTCATCATCTTTCTTCTCACTTAAAGACCCAATTCCATGGAAACTGTATTACAGAGTTTCCGACACCAACGTTCATCAGAGGACCCATTTCGCAAAATTCAAGGGGAAGCTGAAACTGTCGACGGCAAAACATTCCGTAGATATCCCGTTCCGGGCACCGACCGTTAAGATCTTATCTAAACAGTTCACCGACAAAGATGTCGATTTCTCGCACGTCGACTATGGAAGGTGGGAGAGGAAGCTTATCAGATCCGCCTCAACATTAAGATTTGGGCTTCCAAGCCCACTTGAATTAAGACCAGGCGAATCATGGGCCTCTCGTAGTACCATAGGACACAACGATGCGGATTCTGATGTGGGGGACGCCACACATCCGTATAGGGAACTTAACAGACTCGGTACCACCATCCTAGACCCAGGAGACTCCGCTTCAATTGTCGGGGCCCAGAGGGCACAGTCAAATATAACAATGTCAGTGGCACAATTGAGTGAACTTGTGAGGACGACGGTCCAAGAGTGTATTAACAATAATTGTACTCCGTCAGCACCAAAATCATTGAAATAA
Protein Sequence MESSQLVNPPNAFNYIESHRDEYQLSHDLTEIILQFPSTASQLTARLSRSCMKIDHCVIEYRQQVPINATGSVIMEIHDKRMTDNESLQASWTFPIRCNIDLHYFSSSFFSLKDPIPWKLYYRVSDTNVHQRTHFAKFKGKLKLSTAKHSVDIPFRAPTVKILSKQFTDKDVDFSHVDYGRWERKLIRSASTLRFGLPSPLELRPGESWASRSTIGHNDADSDVGDATHPYRELNRLGTTILDPGDSASIVGAQRAQSNITMSVAQLSELVRTTVQECINNNCTPSAPKSLK

References More References in PubMed

1

The genomes of four novel begomoviruses and a new Sida micrantha mosaic virus strain from Bolivian weeds.

Wyant PS, et al.  Arch Virol. 2011 Feb;156(2):347-52. doi: 10.1007/s00705-010-0876-9. Epub 2010 Dec 19.

PMID: 21170729

2

Novel begomoviruses recovered from Pavonia sp. in Brazil.

Pinto VB, et al.  Arch Virol. 2016 Mar;161(3):735-9. doi: 10.1007/s00705-015-2708-4. Epub 2015 Dec 12.

PMID: 26660167