Chickpea yellow dwarf virus


Basic Information

Genus Mastrevirus
NCBI Assembly GCF_000927635.1
Isolate Pakistan
Release date 2015/2/22
Submitter Kraberger,S., Mumtaz,H.H., Briddon,R.W., Martin,D.P., Varsani,A.
Host
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_025475
ATGCTTCCCGCTAAATACCAAGTCTTTCCTGGAGAAAATTACTCTTATACCCCAACTTTCGCGGGAAGTTATCAGGAAGTGCCTACCTCACATAATTCTTCTGGTGAGACTTTTAACAAAGTCTTTGTTGCCCTTATAGTTATATTAATTTCCGTTGGTGTCTGTTATTTGGCTTACGTACTATTCGTTAAGGATCTTATTCTTCTATTGAAGGCTAAAAAACAAAGGACTACAACAGAGATAGGATTTGGTAACACTCCAGGTAGACCTAACAGTCGAAGACAAGAGGATGCCGGGACCGTTTAGTGGTAAAACCTATTCAAGGAAGAAGGGTAAATATGCCAAGGCCTACAAAGCTCTTGGTGTGAAAAATCAAAAAGAACTGGAAGAGCTGGTAAATGCGCCTGCTTGTCCAGTTACTCCTAGACCTGCCTTACAGGTTGCTGAATATTTTTGGACTACGGACAAAAATGGAATGATATTCCGCTCTGGTGGTGGTACTGCTCATTTCACTATGTATCCTCAGGGTTCAAATGAGAATTGCAGACATTCCAACCAGACTAATACCTACAAGATGGCTATTAAGTGCTGGGTTGCATTGGATCCTACGTTCTACAAGAAGGTGGCATGTGTTCCTGTGCATTTCTGGTTGGTATACGACAAAGATCCGGGTAATACACTGCCTGGATGCTCTACCATTTTTGATACTCTGTATCAAGATTACCCGGGTACATGGACTGTATCCCGGAACGTTAGTCGTCGCTTTGTAGTTAAAAAACATTGGCACATTATCTTGGCCTCTAATGGAACGAATCCAACACAAGATCAAGACCCTGCTAAGTATGCTGGACCTGGACCTGTGTTTCAATGGAAACACATGAACAAGTTTTTTAAAAGACTTGGCGTAAGGACTGATTGGAAGAACTCAGCTACAGGTGAAGTAGCTGACATTAAGAGTGGAGCATTGTACTTAGTTTGTGCACCAAGTGGTGGTGCTGTTGTAAGGGTTGGGGGTAGATTCAGAATGTACTTCAAATCCGTTGGAAATCAATAAATTATTTTATTATTTTGTACATATTCTTATCTTACAATATGACCTTGAAAAATAAATACATAACAAAAAACACGCAAAAAATGAACAAAAAACAGAAAACAAACTTATATTATAAACTCTGAGTCAGAAGGAGAGGCACGTTTAGTGACTCGACGCTGCCGAAGCAATAAAAGTCTCTCCTTCACTCATTATATGGATTTTACAATTTAAATAAAAATATTCTCTCTGAGAATCTGACATACTCTCAAGCCAGTCCTCATCATTATTAACTATTATAATACATGGGATTCCTCCTTTAACCCTCTTCTTTTTGCCGTATTTAGGGTTAACTGTGAAATCCTTCTGTGACCCTACTAACTGCTTCCAGTTGGGGCAGAACTTGAAGGGGATGTCGTCGATGACGTTGTATGTTGCGTTGACGTCGTATGTAGTGAAATCGACCCCTCCGTTGAAGTAGTTGTGTCTTCCCAGACTTCTGGCCCAACTGGTCTTTCCGGTACGACTTGGTCCGCAGATGTAGAGGGATCTTCGCCGGAGTTGGAGTTGTTCGGGTTCCTGGTATAATCGTCCATCCAAATCAAGTCTTCAGTTGCAGTTTCTAAAGAAAGATGTGGATGGAGTAGTTGATAAGAATCTACACTTACAACATAGAGGTCTCTGTTAAGCCACTCAGTAATTTCTTCATGGCAGTGAAGAAATTCATCTGGAAATGGGCTTTGATAGGGTGGTTCTATATCTGGAAAGAGTTTGCTTGCACTGTATTCAAGCCAGTGAAGCTTAGTTGCCCATTCATGGGGGAATTCTTGTTTAATCATTTCCAGATACTCCTCTTTAGATGTTGCAGTCTGTATGATAGTTCTCCATCGTTCATCAGATTTGGTTGGGCTGACTCGATGGTTTCTGAAGTCACCTCTGGTGATGATGTTCCCGTCCTTGGATATGTATTCAAGAACCTGCTTTGAGTTCTTAGCAGGTTGGATATTTGGATGGTTTCCCTCAAAATCAAAAAAAGAAGGGTCCCGTATATCACATCTTTTGTCAAGCTGTATAAGACAGTGAAGATGGGGAGAACCATCTTGGTGAAGTTCAGTAGCAATAGCAATGAAAAAAATAGCAAGAGATGTGAGTTTGGACCAGAGAAAATCTCTGAGATTTTCTGCAGTAGAGGAGCTATGAGGATAAGTAAGGAAAACATATTTTGTTTGAAGTCTGAAAGAGTTGTTGTTTGTACGTCTTGGCATGGTTCCTCAAAACAGTGTTTCGAAAACTCTATCTTAACCAGTGAGTGAGGAAAATGAGGAACATATATAGAGAGGTAATTGGGCCTGTTGGGCCTGACACGTGGGCCGCACTCACTGAACTTTAATATTACCAGTGAGTGCGTCTGGCCCACGCGAGCGCGTTAGCGCGAGCGGATTGGTTCTCGCAAAGTAGAATCTCATGAGTGGATTATCTTGTCTATATAAAGGTGCTGCCTTTAATAATTTTCAAAG

Gene Information

NCBI Accession YP_009104361.1
Location 1-306
Protein Name movement protein
Coding Region ATGCTTCCCGCTAAATACCAAGTCTTTCCTGGAGAAAATTACTCTTATACCCCAACTTTCGCGGGAAGTTATCAGGAAGTGCCTACCTCACATAATTCTTCTGGTGAGACTTTTAACAAAGTCTTTGTTGCCCTTATAGTTATATTAATTTCCGTTGGTGTCTGTTATTTGGCTTACGTACTATTCGTTAAGGATCTTATTCTTCTATTGAAGGCTAAAAAACAAAGGACTACAACAGAGATAGGATTTGGTAACACTCCAGGTAGACCTAACAGTCGAAGACAAGAGGATGCCGGGACCGTTTAG
Protein Sequence MLPAKYQVFPGENYSYTPTFAGSYQEVPTSHNSSGETFNKVFVALIVILISVGVCYLAYVLFVKDLILLLKAKKQRTTTEIGFGNTPGRPNSRRQEDAGTV

NCBI Accession YP_009104362.1
Location 290-1054
Protein Name capsid protein
Coding Region ATGCCGGGACCGTTTAGTGGTAAAACCTATTCAAGGAAGAAGGGTAAATATGCCAAGGCCTACAAAGCTCTTGGTGTGAAAAATCAAAAAGAACTGGAAGAGCTGGTAAATGCGCCTGCTTGTCCAGTTACTCCTAGACCTGCCTTACAGGTTGCTGAATATTTTTGGACTACGGACAAAAATGGAATGATATTCCGCTCTGGTGGTGGTACTGCTCATTTCACTATGTATCCTCAGGGTTCAAATGAGAATTGCAGACATTCCAACCAGACTAATACCTACAAGATGGCTATTAAGTGCTGGGTTGCATTGGATCCTACGTTCTACAAGAAGGTGGCATGTGTTCCTGTGCATTTCTGGTTGGTATACGACAAAGATCCGGGTAATACACTGCCTGGATGCTCTACCATTTTTGATACTCTGTATCAAGATTACCCGGGTACATGGACTGTATCCCGGAACGTTAGTCGTCGCTTTGTAGTTAAAAAACATTGGCACATTATCTTGGCCTCTAATGGAACGAATCCAACACAAGATCAAGACCCTGCTAAGTATGCTGGACCTGGACCTGTGTTTCAATGGAAACACATGAACAAGTTTTTTAAAAGACTTGGCGTAAGGACTGATTGGAAGAACTCAGCTACAGGTGAAGTAGCTGACATTAAGAGTGGAGCATTGTACTTAGTTTGTGCACCAAGTGGTGGTGCTGTTGTAAGGGTTGGGGGTAGATTCAGAATGTACTTCAAATCCGTTGGAAATCAATAA
Protein Sequence MPGPFSGKTYSRKKGKYAKAYKALGVKNQKELEELVNAPACPVTPRPALQVAEYFWTTDKNGMIFRSGGGTAHFTMYPQGSNENCRHSNQTNTYKMAIKCWVALDPTFYKKVACVPVHFWLVYDKDPGNTLPGCSTIFDTLYQDYPGTWTVSRNVSRRFVVKKHWHIILASNGTNPTQDQDPAKYAGPGPVFQWKHMNKFFKRLGVRTDWKNSATGEVADIKSGALYLVCAPSGGAVVRVGGRFRMYFKSVGNQ

NCBI Accession YP_009104363.1
Location 1196-1609,1699-2295
Protein Name replication-associated protein
Coding Region ATGCCAAGACGTACAAACAACAACTCTTTCAGACTTCAAACAAAATATGTTTTCCTTACTTATCCTCATAGCTCCTCTACTGCAGAAAATCTCAGAGATTTTCTCTGGTCCAAACTCACATCTCTTGCTATTTTTTTCATTGCTATTGCTACTGAACTTCACCAAGATGGTTCTCCCCATCTTCACTGTCTTATACAGCTTGACAAAAGATGTGATATACGGGACCCTTCTTTTTTTGATTTTGAGGGAAACCATCCAAATATCCAACCTGCTAAGAACTCAAAGCAGGTTCTTGAATACATATCCAAGGACGGGAACATCATCACCAGAGGTGACTTCAGAAACCATCGAGTCAGCCCAACCAAATCTGATGAACGATGGAGAACTATCATACAGACTGCAACATCTAAAGAGGAGTATCTGGAAATGATTAAACAAGAATTCCCCCATGAATGGGCAACTAAGCTTCACTGGCTTGAATACAGTGCAAGCAAACTCTTTCCAGATATAGAACCACCCTATCAAAGCCCATTTCCAGATGAATTTCTTCACTGCCATGAAGAAATTACTGAGTGGCTTAACAGAGACCTCTATGTTGAACCCGAACAACTCCAACTCCGGCGAAGATCCCTCTACATCTGCGGACCAAGTCGTACCGGAAAGACCAGTTGGGCCAGAAGTCTGGGAAGACACAACTACTTCAACGGAGGGGTCGATTTCACTACATACGACGTCAACGCAACATACAACGTCATCGACGACATCCCCTTCAAGTTCTGCCCCAACTGGAAGCAGTTAGTAGGGTCACAGAAGGATTTCACAGTTAACCCTAAATACGGCAAAAAGAAGAGGGTTAAAGGAGGAATCCCATGTATTATAATAGTTAATAATGATGAGGACTGGCTTGAGAGTATGTCAGATTCTCAGAGAGAATATTTTTATTTAAATTGTAAAATCCATATAATGAGTGAAGGAGAGACTTTTATTGCTTCGGCAGCGTCGAGTCACTAA
Protein Sequence MPRRTNNNSFRLQTKYVFLTYPHSSSTAENLRDFLWSKLTSLAIFFIAIATELHQDGSPHLHCLIQLDKRCDIRDPSFFDFEGNHPNIQPAKNSKQVLEYISKDGNIITRGDFRNHRVSPTKSDERWRTIIQTATSKEEYLEMIKQEFPHEWATKLHWLEYSASKLFPDIEPPYQSPFPDEFLHCHEEITEWLNRDLYVEPEQLQLRRRSLYICGPSRTGKTSWARSLGRHNYFNGGVDFTTYDVNATYNVIDDIPFKFCPNWKQLVGSQKDFTVNPKYGKKKRVKGGIPCIIIVNNDEDWLESMSDSQREYFYLNCKIHIMSEGETFIASAASSH

NCBI Accession YP_009104364.1
Location 1408-2295
Protein Name RepA
Coding Region ATGCCAAGACGTACAAACAACAACTCTTTCAGACTTCAAACAAAATATGTTTTCCTTACTTATCCTCATAGCTCCTCTACTGCAGAAAATCTCAGAGATTTTCTCTGGTCCAAACTCACATCTCTTGCTATTTTTTTCATTGCTATTGCTACTGAACTTCACCAAGATGGTTCTCCCCATCTTCACTGTCTTATACAGCTTGACAAAAGATGTGATATACGGGACCCTTCTTTTTTTGATTTTGAGGGAAACCATCCAAATATCCAACCTGCTAAGAACTCAAAGCAGGTTCTTGAATACATATCCAAGGACGGGAACATCATCACCAGAGGTGACTTCAGAAACCATCGAGTCAGCCCAACCAAATCTGATGAACGATGGAGAACTATCATACAGACTGCAACATCTAAAGAGGAGTATCTGGAAATGATTAAACAAGAATTCCCCCATGAATGGGCAACTAAGCTTCACTGGCTTGAATACAGTGCAAGCAAACTCTTTCCAGATATAGAACCACCCTATCAAAGCCCATTTCCAGATGAATTTCTTCACTGCCATGAAGAAATTACTGAGTGGCTTAACAGAGACCTCTATGTTGTAAGTGTAGATTCTTATCAACTACTCCATCCACATCTTTCTTTAGAAACTGCAACTGAAGACTTGATTTGGATGGACGATTATACCAGGAACCCGAACAACTCCAACTCCGGCGAAGATCCCTCTACATCTGCGGACCAAGTCGTACCGGAAAGACCAGTTGGGCCAGAAGTCTGGGAAGACACAACTACTTCAACGGAGGGGTCGATTTCACTACATACGACGTCAACGCAACATACAACGTCATCGACGACATCCCCTTCAAGTTCTGCCCCAACTGGAAGCAGTTAG
Protein Sequence MPRRTNNNSFRLQTKYVFLTYPHSSSTAENLRDFLWSKLTSLAIFFIAIATELHQDGSPHLHCLIQLDKRCDIRDPSFFDFEGNHPNIQPAKNSKQVLEYISKDGNIITRGDFRNHRVSPTKSDERWRTIIQTATSKEEYLEMIKQEFPHEWATKLHWLEYSASKLFPDIEPPYQSPFPDEFLHCHEEITEWLNRDLYVVSVDSYQLLHPHLSLETATEDLIWMDDYTRNPNNSNSGEDPSTSADQVVPERPVGPEVWEDTTTSTEGSISLHTTSTQHTTSSTTSPSSSAPTGSS

References More References in PubMed

1

Chickpea chlorotic dwarf virus: An Emerging Monopartite Dicot Infecting Mastrevirus.

Kanakala S, et al.  Viruses. 2018 Dec 21;11(1):5. doi: 10.3390/v11010005.

PMID: 30577666

2

Identification of New Chickpea Virus and Control of Chickpea Virus Disease.

Cun Z.  Evid Based Complement Alternat Med. 2022 May 28;2022:6465505. doi: 10.1155/2022/6465505. eCollection 2022.

PMID: 35668786

3

Chickpea chlorotic stunt virus: a threat to cool-season food legumes.

Abraham A, et al.  Arch Virol. 2022 Jan;167(1):21-30. doi: 10.1007/s00705-021-05288-4. Epub 2021 Nov 2.

PMID: 34729666

4

First Report of Chickpea Chlorotic Dwarf Virus Infecting Spring Chickpea in Syria.

Kumari SG, et al.  Plant Dis. 2004 Apr;88(4):424. doi: 10.1094/PDIS.2004.88.4.424C.

PMID: 30812628

5

Molecular characterization of chickpea chlorotic dwarf virus and peanut witches' broom phytoplasma associated with chickpea stunt disease and identification of new host crops and leafhopper vectors in India.

Reddy MG, et al.  3 Biotech. 2021 Mar;11(3):112. doi: 10.1007/s13205-020-02613-7. Epub 2021 Feb 3.

PMID: 33598378

6

First Report of Soybean Dwarf Virus Infecting Lentil and Beet Western Yellows Virus Infecting Lentil and Chickpea Crops in Ethiopia.

Tadesse N, et al.  Plant Dis. 1999 Jun;83(6):589. doi: 10.1094/PDIS.1999.83.6.589B.

PMID: 30849845

7

Tomato Yellow Leaf Curl Virus Infection in a Monocotyledonous Weed (Eleusine indica).

Kil EJ, et al.  Plant Pathol J. 2021 Dec;37(6):641-651. doi: 10.5423/PPJ.FT.11.2021.0162. Epub 2021 Dec 1.

PMID: 34897255

8

First Report of Cotton Leafroll Dwarf Virus Infecting Hibiscus syriacus in South Korea.

Igori D, et al.  Plant Dis. 2022 Feb 5. doi: 10.1094/PDIS-11-21-2559-PDN. Online ahead of print.

PMID: 35124992

9

Epidemiology and integrated management of persistently transmitted aphid-borne viruses of legume and cereal crops in West Asia and North Africa.

Makkouk KM, et al.  Virus Res. 2009 May;141(2):209-18. doi: 10.1016/j.virusres.2008.12.007. Epub 2009 Jan 17.

PMID: 19152820

10

First Report of Cotton Leafroll Dwarf Virus infection of Malvaviscus arboreus in China.

Wang L, et al.  Plant Dis. 2023 Apr 20. doi: 10.1094/PDIS-12-22-2909-PDN. Online ahead of print.

PMID: 37079015