Spinach curly top Arizona virus


Basic Information

Genus Becurtovirus
NCBI Assembly GCF_000893115.1
Isolate USA
Release date 2015/2/22
Submitter Hernandez-Zepeda,C., Arguello-Astorga,G., Brown,J.K.
Host
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_015051
CCCTGCAAATGCCTTTACACGTGTCGTAGTATGACTGACTCTTTTAAAAGCGTGCTCCCCACGCTGCCTTTACTTTTCTAAAGTAAAGTTGTGGGACCTACCACGTTACTTTGTTGAATTCAATTATTTGAATTTGAAATTTCTCATGTTATATACCGATAGGGTTTTAGTATATATACATGTATAAATGATGGTCTGTCTACCAGACTGGTTGTTCCTTTTGTTTATTTTGAGTATTCTTCTACAGTCTGGTACCAATTTTTATGGGACCTTTCAGAGTGGGACAGTTTCCAAACAATTATCCTGCGTTGCTAGCCGTGTCGACGAGTTGTTTCTTCAGATACAACAAGTGGTGTATTCTAGGAATACAGCCGGAAATCGAGCCGTTGAGTCTAGAAGACGGCGAGGTCTTTCTTCAGTTCCAGAAGGAAGTGAAGAAGTTGCTGAGGCGTAAGTGCAGTTTCGGTAGAAAGTGCGTTCTTTATCAGGATATTTACAAGGAGTACGTGAAGGATGAGTCAGAAAAGAAAAACGAAGTCGCAGACTTCATGGCCGAAGAAGAGGAAGACGACTTCTGGGAAGAATTATCAATGGAAGCGACCTGTTCAAAAGAACAGGGCGTTGAAGTTGAAGATGTATGATGACATGCTTGGTGCTGGAGGTATTGGTTCAACCATCAGCAATGATGGGTTGATTACTATGCTCAATAATTATGTTCAGGGTATAGGTGACAGTCAGAGGTCTACGAATGTGACTGTTACAAGGCACATGAAGTTCGATATGGCTCTCATGGCCAGTTCTGGGTTTTGGGAGGCTCCCAATTATATGACTCAATATCATTGGATTATTGTTGATCGAGATGTTGGATCTGTCTTTCCGACTAAGTTGGATATGATTTTTGATATTCCTTCTAATGGTCAGGCTATGCCGTCGACCTATAGAATTCGTCGTGATAGTAATGAACGATTTATCGTGAAGAAGAAGTGGACTACGCATATGATGTCTACGGGTACTGATTATGGTGGCAAACAGACTTACAAAGCGCCGTCTCAGCCTAATTATAAGAAGGCTATGAATATTAATGTCAGGAATATCAATGTGAAGACGATATGGAAGGACACCGGAGGTGGAAAATATGAAGATGTTAAAGAGAATGCTCTGTTGTACGTTGTTGTCAACGATAATACTGATAACACTAATATGTATGCCACATTATTTGGTAATTGTAGGTGTTATTTCTATTAATAGTTTGAAATGTATCAATGATATTGAAGGTTGTTATGGAAATATTTGTTTACAAATATTTGTGGTTAATATTAATAAATGGAGATATGTAAATATCTGGTATTCATGACTTGAACAAACAAATTTACATTAAAAACACGCTCAGAAAAAAAACACACTTCGCAATAACTGGGGGAAAAGTCAAATTACAATAGTTTAGTCCTGCCGAGCCGAAGGCGAGGACCTACCTGCAGCCTATTTATTCTACTCTGTAGAATACCAAACTTCATCACTAGATAAATAGTACACTTCGCAGTTTGCGTGGAACCAATCCTTCATTGCATCACTCATACATGGAATCCAGTCCATATCTGGATTTGTTATAGCAATACATGGTCTCCCTCCTGGGATTATGAGGTTTGGTTTGTGTTTTATCCAAACACTATAGTCTTCATTACATCCTATTATGGATTTGAACAACTCTTGTTGTATTTTCATATATCTTATATCATCTATTACATGGTACGTAGTATGTTCAATGTCATAATTGGACCAATCTAGTACCATTCCTGACATGTAGTGATGTCTTCCTAACGATCTTGCCCATTGGGTCTTTCCTGTCCTTGAAGGACCGCAGATGTAGAGACTTCGGGGTCTGACTGGTCTGTTGTCTGGTTCCTGGAAGAATTTAGATCGTTAGGATTTTCACTACATGTTAATTCGTCGCCTAGACGTTCTATGTGGTAATGTTCTGCAATACTTATTTCCCAATCCTGTAGGATTGAACCTCTACAGTTATTACATAGCTCGTAATTAAGACAGTGACTACTTACGAAATATATATTGTGTTCCGCCCACTCTTTGATTTGGTCAGGCAACCTAGTGAACTCCGTCCATCGGGGTAGATAAGGTTGCACAACTGGCCTGAAATGGTAGTTGGCGAAGGCCAAAATTGAAGGCCATCTGAGGACAAAGTCCGTTGGGCAGGATTCTCTGATGTTATTGAAGAACTCGTCCTTGGTGTTGGATGAATCAAGAATTCGTCTCCATTCCAGGTTGCTGTCGCCAAGACGGTTTGGAGAGCGCCCTGCCAGTCGAAGCTCTCCAAAGCATCGTGGTTGTTGGTCCTCCTTGGTGATGTACTCCCAAGCTCGCTTGGGGGCGTTGAGTCCGTCGATTCTTGGATGTATTGTTCTGCCATCTGGTAGGATGATGTTGAAAAACAGGTTCCCATTAACCTGTAATTTTTTATTGCACTGGAATATGCAATGTGTGTGGAATCCCCCTTCAGGGTTTGATTCAGTTGGTTGGTGGTGTTCCAATGCAACTGATAAGAAGAGTACTTCGAATTGTTGGAGTAGGGCTAGTAATTTCTCAAATATATAATCTTTAAAATCCCCACCTATTTGTGAATAGGTGAGAAAAGCATTCTTTTTTTGGAACCGGAAATAACCGGGTCCATTTTGATTAGGACGGTTTCTGGAGGGTGTTCGGGCCATTTTTTATTTCAAAAAGGAAAGAGGGAAATAAGAGTTGTATTTACTCTTTCCGTACTAGGCTGAAAAAAAACTCTATATGTTGGAGTAGAGTAATGTGTTGCTTATATATCAGAGTAAAGGCATTTGCAGATAAGATT

Gene Information

NCBI Accession YP_004207921.1
Location 188-454
Gene Name V3
Protein Name V3
Coding Region ATGATGGTCTGTCTACCAGACTGGTTGTTCCTTTTGTTTATTTTGAGTATTCTTCTACAGTCTGGTACCAATTTTTATGGGACCTTTCAGAGTGGGACAGTTTCCAAACAATTATCCTGCGTTGCTAGCCGTGTCGACGAGTTGTTTCTTCAGATACAACAAGTGGTGTATTCTAGGAATACAGCCGGAAATCGAGCCGTTGAGTCTAGAAGACGGCGAGGTCTTTCTTCAGTTCCAGAAGGAAGTGAAGAAGTTGCTGAGGCGTAA
Protein Sequence MMVCLPDWLFLLFILSILLQSGTNFYGTFQSGTVSKQLSCVASRVDELFLQIQQVVYSRNTAGNRAVESRRRRGLSSVPEGSEEVAEA

NCBI Accession YP_004207922.1
Location 264-641
Gene Name V2
Protein Name V2
Coding Region ATGGGACCTTTCAGAGTGGGACAGTTTCCAAACAATTATCCTGCGTTGCTAGCCGTGTCGACGAGTTGTTTCTTCAGATACAACAAGTGGTGTATTCTAGGAATACAGCCGGAAATCGAGCCGTTGAGTCTAGAAGACGGCGAGGTCTTTCTTCAGTTCCAGAAGGAAGTGAAGAAGTTGCTGAGGCGTAAGTGCAGTTTCGGTAGAAAGTGCGTTCTTTATCAGGATATTTACAAGGAGTACGTGAAGGATGAGTCAGAAAAGAAAAACGAAGTCGCAGACTTCATGGCCGAAGAAGAGGAAGACGACTTCTGGGAAGAATTATCAATGGAAGCGACCTGTTCAAAAGAACAGGGCGTTGAAGTTGAAGATGTATGA
Protein Sequence MGPFRVGQFPNNYPALLAVSTSCFFRYNKWCILGIQPEIEPLSLEDGEVFLQFQKEVKKLLRRKCSFGRKCVLYQDIYKEYVKDESEKKNEVADFMAEEEEDDFWEELSMEATCSKEQGVEVEDV

NCBI Accession YP_004207923.1
Location 514-1245
Gene Name V1
Protein Name coat protein
Coding Region ATGAGTCAGAAAAGAAAAACGAAGTCGCAGACTTCATGGCCGAAGAAGAGGAAGACGACTTCTGGGAAGAATTATCAATGGAAGCGACCTGTTCAAAAGAACAGGGCGTTGAAGTTGAAGATGTATGATGACATGCTTGGTGCTGGAGGTATTGGTTCAACCATCAGCAATGATGGGTTGATTACTATGCTCAATAATTATGTTCAGGGTATAGGTGACAGTCAGAGGTCTACGAATGTGACTGTTACAAGGCACATGAAGTTCGATATGGCTCTCATGGCCAGTTCTGGGTTTTGGGAGGCTCCCAATTATATGACTCAATATCATTGGATTATTGTTGATCGAGATGTTGGATCTGTCTTTCCGACTAAGTTGGATATGATTTTTGATATTCCTTCTAATGGTCAGGCTATGCCGTCGACCTATAGAATTCGTCGTGATAGTAATGAACGATTTATCGTGAAGAAGAAGTGGACTACGCATATGATGTCTACGGGTACTGATTATGGTGGCAAACAGACTTACAAAGCGCCGTCTCAGCCTAATTATAAGAAGGCTATGAATATTAATGTCAGGAATATCAATGTGAAGACGATATGGAAGGACACCGGAGGTGGAAAATATGAAGATGTTAAAGAGAATGCTCTGTTGTACGTTGTTGTCAACGATAATACTGATAACACTAATATGTATGCCACATTATTTGGTAATTGTAGGTGTTATTTCTATTAA
Protein Sequence MSQKRKTKSQTSWPKKRKTTSGKNYQWKRPVQKNRALKLKMYDDMLGAGGIGSTISNDGLITMLNNYVQGIGDSQRSTNVTVTRHMKFDMALMASSGFWEAPNYMTQYHWIIVDRDVGSVFPTKLDMIFDIPSNGQAMPSTYRIRRDSNERFIVKKKWTTHMMSTGTDYGGKQTYKAPSQPNYKKAMNINVRNINVKTIWKDTGGGKYEDVKENALLYVVVNDNTDNTNMYATLFGNCRCYFY

NCBI Accession YP_004207924.1
Location 1489-1791
Gene Name C2
Protein Name C2
Coding Region ATGGTACTAGATTGGTCCAATTATGACATTGAACATACTACGTACCATGTAATAGATGATATAAGATATATGAAAATACAACAAGAGTTGTTCAAATCCATAATAGGATGTAATGAAGACTATAGTGTTTGGATAAAACACAAACCAAACCTCATAATCCCAGGAGGGAGACCATGTATTGCTATAACAAATCCAGATATGGACTGGATTCCATGTATGAGTGATGCAATGAAGGATTGGTTCCACGCAAACTGCGAAGTGTACTATTTATCTAGTGATGAAGTTTGGTATTCTACAGAGTAG
Protein Sequence MVLDWSNYDIEHTTYHVIDDIRYMKIQQELFKSIIGCNEDYSVWIKHKPNLIIPGGRPCIAITNPDMDWIPCMSDAMKDWFHANCEVYYLSSDEVWYSTE

NCBI Accession YP_004207925.1
Location 1815-2723
Gene Name C1
Protein Name replication-associated protein
Coding Region ATGGCCCGAACACCCTCCAGAAACCGTCCTAATCAAAATGGACCCGGTTATTTCCGGTTCCAAAAAAAGAATGCTTTTCTCACCTATTCACAAATAGGTGGGGATTTTAAAGATTATATATTTGAGAAATTACTAGCCCTACTCCAACAATTCGAAGTACTCTTCTTATCAGTTGCATTGGAACACCACCAACCAACTGAATCAAACCCTGAAGGGGGATTCCACACACATTGCATATTCCAGTGCAATAAAAAATTACAGGTTAATGGGAACCTGTTTTTCAACATCATCCTACCAGATGGCAGAACAATACATCCAAGAATCGACGGACTCAACGCCCCCAAGCGAGCTTGGGAGTACATCACCAAGGAGGACCAACAACCACGATGCTTTGGAGAGCTTCGACTGGCAGGGCGCTCTCCAAACCGTCTTGGCGACAGCAACCTGGAATGGAGACGAATTCTTGATTCATCCAACACCAAGGACGAGTTCTTCAATAACATCAGAGAATCCTGCCCAACGGACTTTGTCCTCAGATGGCCTTCAATTTTGGCCTTCGCCAACTACCATTTCAGGCCAGTTGTGCAACCTTATCTACCCCGATGGACGGAGTTCACTAGGTTGCCTGACCAAATCAAAGAGTGGGCGGAACACAATATATATTTCGTAAGTAGTCACTGTCTTAATTACGAGCTATGTAATAACTGTAGAGGTTCAATCCTACAGGATTGGGAAATAAGTATTGCAGAACATTACCACATAGAACGTCTAGGCGACGAATTAACATGTAGTGAAAATCCTAACGATCTAAATTCTTCCAGGAACCAGACAACAGACCAGTCAGACCCCGAAGTCTCTACATCTGCGGTCCTTCAAGGACAGGAAAGACCCAATGGGCAAGATCGTTAG
Protein Sequence MARTPSRNRPNQNGPGYFRFQKKNAFLTYSQIGGDFKDYIFEKLLALLQQFEVLFLSVALEHHQPTESNPEGGFHTHCIFQCNKKLQVNGNLFFNIILPDGRTIHPRIDGLNAPKRAWEYITKEDQQPRCFGELRLAGRSPNRLGDSNLEWRRILDSSNTKDEFFNNIRESCPTDFVLRWPSILAFANYHFRPVVQPYLPRWTEFTRLPDQIKEWAEHNIYFVSSHCLNYELCNNCRGSILQDWEISIAEHYHIERLGDELTCSENPNDLNSSRNQTTDQSDPEVSTSAVLQGQERPNGQDR

References More References in PubMed

1

First report of Pepper yellow dwarf strain of Beet curly top virus and Spinach curly top Arizona virus in red table beet in Idaho, United States.

Ramachandran V, et al.  Plant Dis. 2023 Apr 27. doi: 10.1094/PDIS-12-22-2855-PDN. Online ahead of print.

PMID: 37102723

2

First Report of a New Curtovirus Species, Spinach severe curly top virus, in Commercial Spinach Plants (Spinacia oleracea) from South-Central Arizona.

Hernandez C, et al.  Plant Dis. 2010 Jul;94(7):917. doi: 10.1094/PDIS-94-7-0917B.

PMID: 30743586

3

Fulfilling Koch's postulates for beet curly top Iran virus and proposal for consideration of new genus in the family Geminiviridae.

Heydarnejad J, et al.  Arch Virol. 2013 Feb;158(2):435-43. doi: 10.1007/s00705-012-1485-6. Epub 2012 Oct 19.

PMID: 23081676

4

New World Cactaceae Plants Harbor Diverse Geminiviruses.

Fontenele RS, et al.  Viruses. 2021 Apr 16;13(4):694. doi: 10.3390/v13040694.

PMID: 33923787

5

Establishment of three new genera in the family Geminiviridae: Becurtovirus, Eragrovirus and Turncurtovirus.

Varsani A, et al.  Arch Virol. 2014 Aug;159(8):2193-203. doi: 10.1007/s00705-014-2050-2. Epub 2014 Mar 22.

PMID: 24658781

6

Intergeneric recombination between a new, spinach-infecting curtovirus and a new geminivirus belonging to the genus Becurtovirus: first New World exemplar.

Hernández-Zepeda C, et al.  Arch Virol. 2013 Nov;158(11):2245-54. doi: 10.1007/s00705-013-1733-4. Epub 2013 May 26.

PMID: 23708296