Tomato golden vein virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_002867655.1
Isolate Brazil: Goias
Release date 2018/8/26
Submitter Albuquerque,L.C., Varsani,A., Fernandes,F.R., Pinheiro,B., Martin,D.P., de Tarso Oliveira Ferreira,P., Lemos,T.O., Inoue-Nagata,A.K., Martins,D.P., Ferreira,P.T.O.
Host
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_038807
ACCGGATGGCCGCGCGATTTTTTAAAGTGGTCCCACTGTGAGTGACCAATCAGATTGTGTCTTGGACGGTTATTTATTTCGAAATACTTAGGCGCTAAGTTGTTAAAGTTGTATAAATTAGACATTCATAAGTGGTCGACATATTTTAATTCAAAATGCCAAAGCGAGATGCCCCATGGCGTATAGTGGCAGGGACCACGAAAGTATCCCGCTCTTCTAATTATTCACCTCGGGGAGGTATACCCAAGCGGGATGCTTGGGTAAACAGGCCCATGTACAGGAAGCCCAGGATATATCGTACGTTGAGAGGGCCTGATGTTCCTAAAGGGTGTGAAGGCCCATGTAAAGTTCAATCCTATGAGCAACGTCATGACATTTCTCATCTTGGCAAGGTGATGTGTATCTCTGATGTGACACGTGGTAATGGTATTACACACCGTGTTGGTAAGCGTTTTTGCGTTAAGTCTGTGTACATATTGGGTAAGATATGGATGGACGAAAATATTAAACTGAAGAACCATACCAACAGTGTTATTTTTTGGTTAGTGAGGGATCGTAGACCCTATGGGACACCTATGGATTTTGGTCAGGTGTTTAACATGTTTGATAATGAGCCTAGTACTGCTACGGTGAAGAACGATCTTCGTGATCGTTATCAAGTCATTCATCGATTCAATGCTAAGGTTACGGGTGGACAGTATGCTAGCAACGAGCAAGCTCTTGTTCGGCGTTTCTGGAAGGTCAATAATCATGTAGTTTATAATCATCAGGAAGCCAGCGAAGTACGAGAATCCATACCGGAGAATGCTCTGTTATTGTATATGGCATGTACACATGCCTCTAATCCCGTGTATGCTACTTTGAAAATTCGGATCTATTTTTATGATTCGATTTCAAATTAATAAAGTTTAAATTTTATTGAATGATTTTCGAGTACATAATTTACATAAGATTTGTCTGTTGCGAAACGAACAGCTCTGATTACATTGTTAATGGAAATAATACCTAATTGGTTCAGATACAATAAAACGAAATATCTAAATCTAGTTAAATATGTCATCCCAGAAGCTCTCAGGGATGTCGTCCAGACTTGGAAATTTAGAAATGCCTTGTGGAGACCCAACGCTTTCCGCAGGTTGTGGTTGAAACGTATCTGCACATGGTATATCCTGGTCGTTGTATAATAGGGGTCCTCGACGTTGGTTATCTTGAAATAGAGGGGATTTGTAATCTCCCAAATAAAGACGCCATTCTCTGCTTGAGGCACAGTGATGGGTTCCGCGGTGCGTGAATCCATTATTTCTACAGTTGATGTGGATGTATATGGAGCAGCCGCAGTTTAGGTCTATGCGTTTACGCCTGGTTGTTTTCTGTTTGGCGGCTCTGTGCCGTGGCTTGATAGAGGGGGGAGTTGAGGAAGATGAATTTAGCATTATGCAGTGTCCAAGCTCTTAGAGATGCATTTTCATGTTTGTCAAGGAAGTCTTTATAACTAGCCCCCTCTCCTGGATTGCAAAGCACGATTGATGGGATCCCTCCTTTAATTTGAACCGGCTTTCCGTACTTGCAATTGCTTTGCCAGTCACGCTGGGACCCAATTAGTTCTTTCCAGTGCTTCATTTTTAGATAATGCGGAGTGACATCATCAATGACGTTATACTCCACTTCATTTGAATAAACTTTAGAATTAAAATCCAAGTGTCCACTTAAATAATTATGTGGTCCTAGTGCACGAGCCCACATAGTCTTCCCCGTCCTAGAATCACCCTCAATGATGATACTAATAGGTCTTTCCGGCCGCGCAGCGGCACCCCTTCCGAAATACTCATCAGCCCATTGCTGCATCTCATCAGGAACGTGAGTAAAGGAAGATAATTCAAATATAGGGACCCATGGGGCTGGAGCCTTTGCAAATATTTTTTGGACATGTGATTGTATTTTGTCCAAATGAAGAACATAATCTCTAGGTTGTTCTTCTTTTAATATATTTAAGGCCTTGGATAGATTTTCTGCGTTTAGAACCTTCGCATAAGTGTCATTGGCAGTTTGGCAGCCTCCTCTTGCTGATCTTCCATCGATCTGGAAATTTCCAAAATCAATGAAGTCTCCGTCTTTTTCCATGTAGGTCTTGACGTCGGACGAGCTTTTAGCTCCCTGAATGTTTGGATGGAAATGTGCTGATCTTGTTGGGGATACCAAGTCGAAGAACCGTTGATTCTGGCATTTGAATTTGCCTTCGAATTGAATAAGCACATGGAGATGAGGTTCCCCATCTTCGTGAAATTCTCTGGTTACACGAATAAATTTCTTGTTTGTTGGTGTTTTAAGTGTCTGTAATTGGGAAAGTGTTTCCTCTTTGGTTAATGAACAATGAGGGTATGTAAGGAAGAAATTTTTTGCATTTACAGTGAAACGCTTTGGTGGTGGCATTGTAGTAAATAAGAAGATGAGACCCGATAGCTCTCCTTCAAACTTGGCGAAATGAATTGGGGAATGGGTCTCAATATATAGTAGAGTCCATTATAGAATATAATTGCCACGTGGCGGCCATCCGATATAATATT

Gene Information

NCBI Accession YP_009508029.1
Location 156-902
Protein Name V1
Coding Region ATGCCAAAGCGAGATGCCCCATGGCGTATAGTGGCAGGGACCACGAAAGTATCCCGCTCTTCTAATTATTCACCTCGGGGAGGTATACCCAAGCGGGATGCTTGGGTAAACAGGCCCATGTACAGGAAGCCCAGGATATATCGTACGTTGAGAGGGCCTGATGTTCCTAAAGGGTGTGAAGGCCCATGTAAAGTTCAATCCTATGAGCAACGTCATGACATTTCTCATCTTGGCAAGGTGATGTGTATCTCTGATGTGACACGTGGTAATGGTATTACACACCGTGTTGGTAAGCGTTTTTGCGTTAAGTCTGTGTACATATTGGGTAAGATATGGATGGACGAAAATATTAAACTGAAGAACCATACCAACAGTGTTATTTTTTGGTTAGTGAGGGATCGTAGACCCTATGGGACACCTATGGATTTTGGTCAGGTGTTTAACATGTTTGATAATGAGCCTAGTACTGCTACGGTGAAGAACGATCTTCGTGATCGTTATCAAGTCATTCATCGATTCAATGCTAAGGTTACGGGTGGACAGTATGCTAGCAACGAGCAAGCTCTTGTTCGGCGTTTCTGGAAGGTCAATAATCATGTAGTTTATAATCATCAGGAAGCCAGCGAAGTACGAGAATCCATACCGGAGAATGCTCTGTTATTGTATATGGCATGTACACATGCCTCTAATCCCGTGTATGCTACTTTGAAAATTCGGATCTATTTTTATGATTCGATTTCAAATTAA
Protein Sequence MPKRDAPWRIVAGTTKVSRSSNYSPRGGIPKRDAWVNRPMYRKPRIYRTLRGPDVPKGCEGPCKVQSYEQRHDISHLGKVMCISDVTRGNGITHRVGKRFCVKSVYILGKIWMDENIKLKNHTNSVIFWLVRDRRPYGTPMDFGQVFNMFDNEPSTATVKNDLRDRYQVIHRFNAKVTGGQYASNEQALVRRFWKVNNHVVYNHQEASEVRESIPENALLLYMACTHASNPVYATLKIRIYFYDSISN

NCBI Accession YP_009508030.1
Location 899-1297
Protein Name C3
Coding Region ATGGATTCACGCACCGCGGAACCCATCACTGTGCCTCAAGCAGAGAATGGCGTCTTTATTTGGGAGATTACAAATCCCCTCTATTTCAAGATAACCAACGTCGAGGACCCCTATTATACAACGACCAGGATATACCATGTGCAGATACGTTTCAACCACAACCTGCGGAAAGCGTTGGGTCTCCACAAGGCATTTCTAAATTTCCAAGTCTGGACGACATCCCTGAGAGCTTCTGGGATGACATATTTAACTAGATTTAGATATTTCGTTTTATTGTATCTGAACCAATTAGGTATTATTTCCATTAACAATGTAATCAGAGCTGTTCGTTTCGCAACAGACAAATCTTATGTAAATTATGTACTCGAAAATCATTCAATAAAATTTAAACTTTATTAA
Protein Sequence MDSRTAEPITVPQAENGVFIWEITNPLYFKITNVEDPYYTTTRIYHVQIRFNHNLRKALGLHKAFLNFQVWTTSLRASGMTYLTRFRYFVLLYLNQLGIISINNVIRAVRFATDKSYVNYVLENHSIKFKLY

NCBI Accession YP_009508031.1
Location 1044-1433
Protein Name C2
Coding Region ATGCTAAATTCATCTTCCTCAACTCCCCCCTCTATCAAGCCACGGCACAGAGCCGCCAAACAGAAAACAACCAGGCGTAAACGCATAGACCTAAACTGCGGCTGCTCCATATACATCCACATCAACTGTAGAAATAATGGATTCACGCACCGCGGAACCCATCACTGTGCCTCAAGCAGAGAATGGCGTCTTTATTTGGGAGATTACAAATCCCCTCTATTTCAAGATAACCAACGTCGAGGACCCCTATTATACAACGACCAGGATATACCATGTGCAGATACGTTTCAACCACAACCTGCGGAAAGCGTTGGGTCTCCACAAGGCATTTCTAAATTTCCAAGTCTGGACGACATCCCTGAGAGCTTCTGGGATGACATATTTAACTAG
Protein Sequence MLNSSSSTPPSIKPRHRAAKQKTTRRKRIDLNCGCSIYIHINCRNNGFTHRGTHHCASSREWRLYLGDYKSPLFQDNQRRGPLLYNDQDIPCADTFQPQPAESVGSPQGISKFPSLDDIPESFWDDIFN

NCBI Accession YP_009508032.1
Location 1354-2430
Protein Name C1
Coding Region ATGCCACCACCAAAGCGTTTCACTGTAAATGCAAAAAATTTCTTCCTTACATACCCTCATTGTTCATTAACCAAAGAGGAAACACTTTCCCAATTACAGACACTTAAAACACCAACAAACAAGAAATTTATTCGTGTAACCAGAGAATTTCACGAAGATGGGGAACCTCATCTCCATGTGCTTATTCAATTCGAAGGCAAATTCAAATGCCAGAATCAACGGTTCTTCGACTTGGTATCCCCAACAAGATCAGCACATTTCCATCCAAACATTCAGGGAGCTAAAAGCTCGTCCGACGTCAAGACCTACATGGAAAAAGACGGAGACTTCATTGATTTTGGAAATTTCCAGATCGATGGAAGATCAGCAAGAGGAGGCTGCCAAACTGCCAATGACACTTATGCGAAGGTTCTAAACGCAGAAAATCTATCCAAGGCCTTAAATATATTAAAAGAAGAACAACCTAGAGATTATGTTCTTCATTTGGACAAAATACAATCACATGTCCAAAAAATATTTGCAAAGGCTCCAGCCCCATGGGTCCCTATATTTGAATTATCTTCCTTTACTCACGTTCCTGATGAGATGCAGCAATGGGCTGATGAGTATTTCGGAAGGGGTGCCGCTGCGCGGCCGGAAAGACCTATTAGTATCATCATTGAGGGTGATTCTAGGACGGGGAAGACTATGTGGGCTCGTGCACTAGGACCACATAATTATTTAAGTGGACACTTGGATTTTAATTCTAAAGTTTATTCAAATGAAGTGGAGTATAACGTCATTGATGATGTCACTCCGCATTATCTAAAAATGAAGCACTGGAAAGAACTAATTGGGTCCCAGCGTGACTGGCAAAGCAATTGCAAGTACGGAAAGCCGGTTCAAATTAAAGGAGGGATCCCATCAATCGTGCTTTGCAATCCAGGAGAGGGGGCTAGTTATAAAGACTTCCTTGACAAACATGAAAATGCATCTCTAAGAGCTTGGACACTGCATAATGCTAAATTCATCTTCCTCAACTCCCCCCTCTATCAAGCCACGGCACAGAGCCGCCAAACAGAAAACAACCAGGCGTAA
Protein Sequence MPPPKRFTVNAKNFFLTYPHCSLTKEETLSQLQTLKTPTNKKFIRVTREFHEDGEPHLHVLIQFEGKFKCQNQRFFDLVSPTRSAHFHPNIQGAKSSSDVKTYMEKDGDFIDFGNFQIDGRSARGGCQTANDTYAKVLNAENLSKALNILKEEQPRDYVLHLDKIQSHVQKIFAKAPAPWVPIFELSSFTHVPDEMQQWADEYFGRGAAARPERPISIIIEGDSRTGKTMWARALGPHNYLSGHLDFNSKVYSNEVEYNVIDDVTPHYLKMKHWKELIGSQRDWQSNCKYGKPVQIKGGIPSIVLCNPGEGASYKDFLDKHENASLRAWTLHNAKFIFLNSPLYQATAQSRQTENNQA

NCBI Accession YP_009508033.1
Location 2016-2273
Protein Name C4
Coding Region ATGGGGAACCTCATCTCCATGTGCTTATTCAATTCGAAGGCAAATTCAAATGCCAGAATCAACGGTTCTTCGACTTGGTATCCCCAACAAGATCAGCACATTTCCATCCAAACATTCAGGGAGCTAAAAGCTCGTCCGACGTCAAGACCTACATGGAAAAAGACGGAGACTTCATTGATTTTGGAAATTTCCAGATCGATGGAAGATCAGCAAGAGGAGGCTGCCAAACTGCCAATGACACTTATGCGAAGGTTCTAA
Protein Sequence MGNLISMCLFNSKANSNARINGSSTWYPQQDQHISIQTFRELKARPTSRPTWKKTETSLILEISRSMEDQQEEAAKLPMTLMRRF

References More References in PubMed

1

Tomato yellow vein streak virus and Tomato golden vein virus: a reappraisal of the classification status of two South American Begomovirus species based upon genome-wide pairwise identity of multiple isolates.

Dos Reis LNA, et al.  Virus Genes. 2021 Feb;57(1):127-131. doi: 10.1007/s11262-020-01810-z. Epub 2020 Nov 19.

PMID: 33211226

2

Cloned tomato golden mosaic virus back in tomatoes.

Wyant PS, et al.  Virus Res. 2012 Aug;167(2):397-403. doi: 10.1016/j.virusres.2012.05.021. Epub 2012 Jun 4.

PMID: 22677771

3

Identification of sequences required for AL2-mediated activation of the tomato golden mosaic virus-yellow vein BR1 promoter.

Berger MR, et al.  J Gen Virol. 2013 Jun;94(Pt 6):1398-1406. doi: 10.1099/vir.0.050161-0. Epub 2013 Mar 13.

PMID: 23486662

4

Determinants of tomato golden mosaic virus symptom development located on DNA B.

von Arnim A, et al.  Virology. 1992 Jan;186(1):286-93. doi: 10.1016/0042-6822(92)90083-2.

PMID: 1727604

5

The distinct disease phenotypes of the common and yellow vein strains of Tomato golden mosaic virus are determined by nucleotide differences in the 3'-terminal region of the gene encoding the movement protein.

Saunders K, et al.  J Gen Virol. 2001 Jan;82(Pt 1):45-51. doi: 10.1099/0022-1317-82-1-45.

PMID: 11125157

6

Characterization and distribution of tomato yellow margin leaf curl virus, a begomovirus from Venezuela.

Nava A, et al.  Arch Virol. 2013 Feb;158(2):399-406. doi: 10.1007/s00705-012-1501-x. Epub 2012 Oct 14.

PMID: 23064695

7

Further characterization of tomato-infecting begomoviruses in Brazil.

Albuquerque LC, et al.  Arch Virol. 2012 Apr;157(4):747-52. doi: 10.1007/s00705-011-1213-7. Epub 2012 Jan 5.

PMID: 22218964

8

Reconstruction and Characterization of Full-Length Begomovirus and Alphasatellite Genomes Infecting Pepper through Metagenomics.

Bornancini VA, et al.  Viruses. 2020 Feb 11;12(2):202. doi: 10.3390/v12020202.

PMID: 32054104

9

Complete genome sequence of a new bipartite begomovirus infecting tomato in Brazil.

Rego-Machado CM, et al.  Arch Virol. 2019 Nov;164(11):2873-2875. doi: 10.1007/s00705-019-04380-0. Epub 2019 Aug 20.

PMID: 31432269

10

First Report of Tobacco Ringspot Virus Infecting Pawpaw Orchard (Asimina triloba (L.) Dunal) in North America.

Maclot FJ, et al.  Plant Dis. 2022 Dec 26. doi: 10.1094/PDIS-11-22-2639-PDN. Online ahead of print.

PMID: 36572972