Tomato chlorotic leaf distortion virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_000894835.3
Isolate Venezuela
Release date 2016/8/8
Submitter Zambrano,K., Geraud-Pouey,F., Chirinos,D., Romay,G., Marys,E., Geraud,F.
Host
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_015961
ACCGGATGGCCGCGCGATTTTTTGCCCCCCTTCGCGCGATTTTACTCTCTTGCCCTCGCGCGCTCGCTCTCCGTACGCGCTGGTGTGCAGTGGTGTACCGCTTTTGCCCTTGGTGCCCGTTTGAATTAAAGGCTCTTTAATTCAAAAATATCTCGACTTTCGGCAATTTCTATGGCTCTCTCTCTTCTGTCAACGTGGCGCATTATAGACCATGGTCTTAAATAAGTTAAGCTTGAACATGTAGAAATTGCCTTACATGGCACGACAATTCATTGCCGATTGTTCATGCCTTGCTACGTGGACCATTTAAATTCCTTGTTGGCAGCCAATTTAAATGCTTGTTTAACTGATTTATTTATAAATACTTTATATGGTGGGAATGAATTCATTATAACGTCTGTGTATAGGCAATAGTTAATTGTGTATATTTTATAATTGAAGATGTTCTCTGTTAGGTACAGACGTGGAGCCTACCACAGTCAACCACGTGGACAAACACGTCAGCCTATGTTTAAAAGGCAGGCCCATGTTAAACGCAATGATGGCAGGCGTCGAGCGACCCAGAATCTGAAGGCCTCTGATGAGCCCAAGATGACTGCCCAGCGGATTCACGAGAACCAGTACGGTTCGGAGTTTATGATGGCCCACAATACAGCCATATCCACTTTCATCAGCTACCCTGAGTTATGCAAAGCCCAACCGAACCGAACTAGGTCGTACATCAAGTTGAAACGGCTGCGTTTCAAGGGAACTGTGAAGATTGAACGTGTTGCCACTGACGTCAGCATGGATGGTTATGGCCCCAAGACGGAAGGGGTATTCACAATGGTCATAGTTGTTGACCGCAAACCGCATTTGCCTGCGTCTGGGTGCCTGCCAACCTTCGATGAACTCTTCGGTGCAAGAATCCACAGCCATGGTAACTTGGCCGTATCTCCTTCACTGAAAGACCGTTTCTACATACGCCACGTGTTGAAGCGAGTATTGTCCGTGGAGAAGGACAGTCTGATGGTAGACGTGGAAGGATCAACTGCCCTGTCTAATAGGCGTTTTAATTGTTGGTCTAGTTTTAAGGACCTTGATGTTGAGTCACGTAAGGGTGTTTATGACAACATAAGCAAGAACGCCCTGTTAGTTTATTACTGTTGGATGTCTGACACCGTGTCCAAGGCATCGACATTTGTATCGTTTGACCTCGATTATATCGGGTGATTAATGAAAAGGCACTATTAATTTAAATAAAATTCATTTTTATTTCAAGTTCTTGGGCTGTGCCCCACTACAATTGCTCTTAATACATTCTTGGACCGTAGTCCTTACTAGTTCGTTTAATTGGGCCACCGACATCGTAATGTTGGACTCTGCCCTTCTCGCCCCCACCATGGATGCAGACTCACCCGGATCTATTGCGCTTGACCCGAGCCTGTGCAGCTCTCTGTATGGGTGGATCTCGTTCTCCGTCTCGGAGTCCGCGTCCGATGGGCCAATGCCAACTGCGCTCCTTGAAGCCCATGATTCACCAGGCCTAATTTCAATTGGGCCTCTGAGCCCAACACGAGACATGGACGCGCATCTCAATGTCTTCCTTTCCCATCGTCCGTAGTCCACGTGTGAGAAATCCACGTCCTTCTCTGTGAATTGTTTGGAGTGGATTTTTACAGTCGGTGCTCTGAACGGGATGTCGACGGAATGTTTCGCCGTCGACAGTTTCAGCTTCCCCTTGAATTTCGTGAAGTGGGTCTGCTGCTGGACGTTCGTGTCGCACACTCTGTAGTAGAGTTTCCATGGAATCGGGTCCTTCAAGGAGAAGAAGGACGATGAAAAATAGTGGAGATCTATGTTGCACCTGATCGGAAAAGTCCACGATGCCTGTAAAGACTCGTTGTCAGTCAGTCTCCGGTCGTGAATCTCCACAATTACCGTCCCGGTGGCGTTTATGGGTACCTGTTGCCTGTATTCGATGACGCAATGGTCGATTTTCATACAGCTCCGACTAAGCCTCGCCGTCAATTGAGCCGCCGTTGATGGAAATTGGAGGAATATCTCAGTTAAGTCATGGGAAAGCTGATACTCGTCTCGATGGGACTCAATGTAGTTGAAAGCACTGGGAGGATTAACTAACTGAGATTCCATTTGAAGAATATTAGGTCGCGCAGCGACACGGGTTGAAGAAGATGAACAAGGAGTGAAAGTGAACAAGAATTGTCGAAGAAGGTAAACAGGAACTTAGTGAGGAAGTCAAAACAGATAAATCTGTTCTGGGTGGTTATGAAAATCAGTTTATATTTACTGATTTTGTTGTGAAGGTAGAAATTGTGTTTAAGATCTTCTGTTTTTGAGAAAGAGAAGAGTGCTGAAGAAGAATTTGAGGATAATTGTTAAGAGGAAGATGATCAGAGAGAAGTCGTTCTGGGAAATTATGTTAATAATTGGGAAAGTTCTTCTTCTATTTATAAATGTATGGTGGCATTTTTGTAATAAGAGGGGTGTACACCGATTGAGCTCCTCTCAAACTTGCTGATTGTATTGGTGTATTGGGGTAACTTATATACTAGAAGGTTCATTAACGGATCTTCGACACGTGGCGGCCATCCGCTATAATATT

NC_015962
ACCGGATGGCCGCGCGATTTTTTCCCCCACCCGTACGCGCGCCCCGCCTTTAATTTGAGTTAAAGCGAAATCTTTCGCGTCGTCCAATGATATTGCGTCTGACCAGCCTAGATATTTGCAAAAAACTTGGGCCCTAAGTTTTTGGGTGGTTATAAATTAAAGGCTTAACGGGCCTATGTCTTTAATTCAAAATGCCTAAGCGCGATCTCCCATGGCGCGCGATGCCCGGTACGTCAAAGGTCACCCGCAATGCGAATTACTCCCCACGCGCACGCATCGGCCCAACAACGAACAGGGCCACGGAATGGGTTAACAGGCCCATGTACAGGAAGCCCAGAATATATCGGACGCTAAGGACTCCCGATGTTCCAAGAGGTTGTGAAGGCCCGTGTAAGGTCCAGTCTTATGAACAGCGTCACGATATTGCTCACACTGGTAAGGTGATGTGTATTTCCGATGTGACACGTGGCAATGGTATTACCCACCGTGTTGGTAAGCGTTTCTGTGTTAAGTCCGTATACATATTAGGCAAGGTGTGGATGGATGACAACATCAAGTTGAAGAACCACACTAACAGCGTTATGTTCTGGTTAGTTAGGGACCGGAGACCGTATGGCACTCCTATGGATTTTGGACAGGTATTTAATATGTTTGATAATGAGCCCAGCACTGCCACCGTTAAGAACGATCTCCGTGATCGTTACCAGGTGATGAAGAAGTTCTATGCCAAGGTGACAGGTGGACAGTATGCCAGCAACGAGCAGGCTCTGGTCAAGCGTTTCTGGAAGGTCAACAATTATGTGGTGTACAACCACCAGGAGGCTGGGAAGTATGAGAATCATACGGAGAACGCCCTGTTATTGTATATGGCATGTACCCATGCCTCTAACCCCGTGTATGCAACCCTTAAGATTCGGATCTACTTCTACGATTCGATAATGAATTAATAAAGTTTGAATTTTATTGAATGATTTTCTAGTACATGATTGACGTACGCCTTGTCGGTGGCGTATCGTACAGCTCTAATTACATTGTTAAGGGAAATTACGCCTAACTGATCTAAATACATCATAACTAAATGCCTAAACCTAAACAAATAAGTCTTCCCAGAAGCTTTCAGGGATGTCGTCCAGACTTGGAAATTCAGGTAGGCTTTGTGGAGATGCAACGCTCTCCTGAGGTTGTGGTTGAACCGTATCTGGAGGTGGTACACCCTCGTTCTGGTGTATGGCATGTCCTCTACCTGGGAAATCTTGAAATACAGGGGATTTGTTATCTCCCAGATATAAACGCCATTCTCTGCTTGACGCGCATTGATGAATTCCCCTGTGCGTGAATCCATGATCTCTGCAGTTTATGTCTACGTAAGCTGTGCAATTGCACCCCCAGTCAAGACGCCGTCTCCTGATGGCTCTCCTCTTGGGCTGTTTCTTCTTGGCCTGCCTGTGTCTCTTCTTGATACAGGGGGGAGTCGAGTGTGATGAAGACAGCATTCTTGAGTGTCCAGTTCCTGAGGGATGCGTTTTCCTCTTTGTTCAGGAAATCTTTATAGCTGGCACCCTCACCTGGATTGCAGAGCACGATTGATGGGATCCCTCCTTTAATTTGAACTGGCTTCCCGTACTTGCAATTTGACTGCCAGTCTTTTTGGGCCCCAAGGAGCTCTTTCCAGTGCTTCAACTTTAAGTATTGCGGAGAGACGTCATCAATGACGTTATATTCCACTTCGTTCGAGTAAACCTTTGAGTTGAAGTCCAGGTGTCCACTCAGATAATTATGTGGGCCTAAGGCACGAGCCCACATCGTCTTGCCTGTTCTTGAATCACCCTCAACTATGAGACTTATTGGACGATTTGGCCGCGCAGCGGAATCAAGCCCAAAATAACTATCGGCCCACTCTTGCATCTCGTCCGGAACGTTAGTGAAAGAGGAGAGACGAAACGGAGGGACCCACGGTTCCGGAGCCTTCTTGAATATTCTGGTTGCGTTAGCAACCAGGTTGTGGTGTTGAAGGAAGAAATGTTGTGGTTGTTCTTCCTTTATGATTTGCAGAGCTTGCTCGGCAGAGGCAGCATTCAACGCCTTTGCGTATGTATCGTTGACTGTTTGCTGACCTCCTCTTGCAGATCTGCCGTCGATCTGGAATTCTCCCCATTCAATGGTGTCTCCATCCTTGTCGATGTAGGACTTAACGTCCGAGCTTGATTTAKCTCCCTGAATGTTTGGATGGAAATGTGCTGACCTGGTTGGGGAGACCAGATCGAAGAATCTGTTATTCGTGCACTGGTACTTCCCCTCGAACTGGATGAGTATGTGGAGATGAGGCTCCCCATTCTCGTGAAGCTCTCTGCAGATTTTGATGAACTTCTTGTTTACTGGGGTTTTTAGGTTTTGTAATTGGGAAAGTGCTTCTTCTTTAGTAAGAGAGCACTGGGGATAAGTGAGGAAATAGTTTTTGGAGTTAATTCTAAATTTCTTAGGCGGTGGCATTTTTGTAATAAGAGGGGTGTACACCGATTGAGCTCCTCTCAAACTTGCTGATTGTATTGGTGTATTGGGGTAACTTATATACTAGAAGGTTCATTAACGGATCGTTGACACGTGGCGGCCATCCGCTATAATATT

Gene Information

NCBI Accession YP_004821540.1
Location 442-1212
Gene Name BV1
Protein Name nuclear shuttle protein
Coding Region ATGTTCTCTGTTAGGTACAGACGTGGAGCCTACCACAGTCAACCACGTGGACAAACACGTCAGCCTATGTTTAAAAGGCAGGCCCATGTTAAACGCAATGATGGCAGGCGTCGAGCGACCCAGAATCTGAAGGCCTCTGATGAGCCCAAGATGACTGCCCAGCGGATTCACGAGAACCAGTACGGTTCGGAGTTTATGATGGCCCACAATACAGCCATATCCACTTTCATCAGCTACCCTGAGTTATGCAAAGCCCAACCGAACCGAACTAGGTCGTACATCAAGTTGAAACGGCTGCGTTTCAAGGGAACTGTGAAGATTGAACGTGTTGCCACTGACGTCAGCATGGATGGTTATGGCCCCAAGACGGAAGGGGTATTCACAATGGTCATAGTTGTTGACCGCAAACCGCATTTGCCTGCGTCTGGGTGCCTGCCAACCTTCGATGAACTCTTCGGTGCAAGAATCCACAGCCATGGTAACTTGGCCGTATCTCCTTCACTGAAAGACCGTTTCTACATACGCCACGTGTTGAAGCGAGTATTGTCCGTGGAGAAGGACAGTCTGATGGTAGACGTGGAAGGATCAACTGCCCTGTCTAATAGGCGTTTTAATTGTTGGTCTAGTTTTAAGGACCTTGATGTTGAGTCACGTAAGGGTGTTTATGACAACATAAGCAAGAACGCCCTGTTAGTTTATTACTGTTGGATGTCTGACACCGTGTCCAAGGCATCGACATTTGTATCGTTTGACCTCGATTATATCGGGTGA
Protein Sequence MFSVRYRRGAYHSQPRGQTRQPMFKRQAHVKRNDGRRRATQNLKASDEPKMTAQRIHENQYGSEFMMAHNTAISTFISYPELCKAQPNRTRSYIKLKRLRFKGTVKIERVATDVSMDGYGPKTEGVFTMVIVVDRKPHLPASGCLPTFDELFGARIHSHGNLAVSPSLKDRFYIRHVLKRVLSVEKDSLMVDVEGSTALSNRRFNCWSSFKDLDVESRKGVYDNISKNALLVYYCWMSDTVSKASTFVSFDLDYIG

NCBI Accession YP_004821541.1
Location 1252-2133
Gene Name BC1
Protein Name movement protein
Coding Region ATGGAATCTCAGTTAGTTAATCCTCCCAGTGCTTTCAACTACATTGAGTCCCATCGAGACGAGTATCAGCTTTCCCATGACTTAACTGAGATATTCCTCCAATTTCCATCAACGGCGGCTCAATTGACGGCGAGGCTTAGTCGGAGCTGTATGAAAATCGACCATTGCGTCATCGAATACAGGCAACAGGTACCCATAAACGCCACCGGGACGGTAATTGTGGAGATTCACGACCGGAGACTGACTGACAACGAGTCTTTACAGGCATCGTGGACTTTTCCGATCAGGTGCAACATAGATCTCCACTATTTTTCATCGTCCTTCTTCTCCTTGAAGGACCCGATTCCATGGAAACTCTACTACAGAGTGTGCGACACGAACGTCCAGCAGCAGACCCACTTCACGAAATTCAAGGGGAAGCTGAAACTGTCGACGGCGAAACATTCCGTCGACATCCCGTTCAGAGCACCGACTGTAAAAATCCACTCCAAACAATTCACAGAGAAGGACGTGGATTTCTCACACGTGGACTACGGACGATGGGAAAGGAAGACATTGAGATGCGCGTCCATGTCTCGTGTTGGGCTCAGAGGCCCAATTGAAATTAGGCCTGGTGAATCATGGGCTTCAAGGAGCGCAGTTGGCATTGGCCCATCGGACGCGGACTCCGAGACGGAGAACGAGATCCACCCATACAGAGAGCTGCACAGGCTCGGGTCAAGCGCAATAGATCCGGGTGAGTCTGCATCCATGGTGGGGGCGAGAAGGGCAGAGTCCAACATTACGATGTCGGTGGCCCAATTAAACGAACTAGTAAGGACTACGGTCCAAGAATGTATTAAGAGCAATTGTAGTGGGGCACAGCCCAAGAACTTGAAATAA
Protein Sequence MESQLVNPPSAFNYIESHRDEYQLSHDLTEIFLQFPSTAAQLTARLSRSCMKIDHCVIEYRQQVPINATGTVIVEIHDRRLTDNESLQASWTFPIRCNIDLHYFSSSFFSLKDPIPWKLYYRVCDTNVQQQTHFTKFKGKLKLSTAKHSVDIPFRAPTVKIHSKQFTEKDVDFSHVDYGRWERKTLRCASMSRVGLRGPIEIRPGESWASRSAVGIGPSDADSETENEIHPYRELHRLGSSAIDPGESASMVGARRAESNITMSVAQLNELVRTTVQECIKSNCSGAQPKNLK

NCBI Accession YP_004821542.1
Location 192-947
Gene Name AV1
Protein Name capsid protein
Coding Region ATGCCTAAGCGCGATCTCCCATGGCGCGCGATGCCCGGTACGTCAAAGGTCACCCGCAATGCGAATTACTCCCCACGCGCACGCATCGGCCCAACAACGAACAGGGCCACGGAATGGGTTAACAGGCCCATGTACAGGAAGCCCAGAATATATCGGACGCTAAGGACTCCCGATGTTCCAAGAGGTTGTGAAGGCCCGTGTAAGGTCCAGTCTTATGAACAGCGTCACGATATTGCTCACACTGGTAAGGTGATGTGTATTTCCGATGTGACACGTGGCAATGGTATTACCCACCGTGTTGGTAAGCGTTTCTGTGTTAAGTCCGTATACATATTAGGCAAGGTGTGGATGGATGACAACATCAAGTTGAAGAACCACACTAACAGCGTTATGTTCTGGTTAGTTAGGGACCGGAGACCGTATGGCACTCCTATGGATTTTGGACAGGTATTTAATATGTTTGATAATGAGCCCAGCACTGCCACCGTTAAGAACGATCTCCGTGATCGTTACCAGGTGATGAAGAAGTTCTATGCCAAGGTGACAGGTGGACAGTATGCCAGCAACGAGCAGGCTCTGGTCAAGCGTTTCTGGAAGGTCAACAATTATGTGGTGTACAACCACCAGGAGGCTGGGAAGTATGAGAATCATACGGAGAACGCCCTGTTATTGTATATGGCATGTACCCATGCCTCTAACCCCGTGTATGCAACCCTTAAGATTCGGATCTACTTCTACGATTCGATAATGAATTAA
Protein Sequence MPKRDLPWRAMPGTSKVTRNANYSPRARIGPTTNRATEWVNRPMYRKPRIYRTLRTPDVPRGCEGPCKVQSYEQRHDIAHTGKVMCISDVTRGNGITHRVGKRFCVKSVYILGKVWMDDNIKLKNHTNSVMFWLVRDRRPYGTPMDFGQVFNMFDNEPSTATVKNDLRDRYQVMKKFYAKVTGGQYASNEQALVKRFWKVNNYVVYNHQEAGKYENHTENALLLYMACTHASNPVYATLKIRIYFYDSIMN

NCBI Accession YP_004821543.1
Location 944-1342
Gene Name AC3
Protein Name replication enhancer protein
Coding Region ATGGATTCACGCACAGGGGAATTCATCAATGCGCGTCAAGCAGAGAATGGCGTTTATATCTGGGAGATAACAAATCCCCTGTATTTCAAGATTTCCCAGGTAGAGGACATGCCATACACCAGAACGAGGGTGTACCACCTCCAGATACGGTTCAACCACAACCTCAGGAGAGCGTTGCATCTCCACAAAGCCTACCTGAATTTCCAAGTCTGGACGACATCCCTGAAAGCTTCTGGGAAGACTTATTTGTTTAGGTTTAGGCATTTAGTTATGATGTATTTAGATCAGTTAGGCGTAATTTCCCTTAACAATGTAATTAGAGCTGTACGATACGCCACCGACAAGGCGTACGTCAATCATGTACTAGAAAATCATTCAATAAAATTCAAACTTTATTAA
Protein Sequence MDSRTGEFINARQAENGVYIWEITNPLYFKISQVEDMPYTRTRVYHLQIRFNHNLRRALHLHKAYLNFQVWTTSLKASGKTYLFRFRHLVMMYLDQLGVISLNNVIRAVRYATDKAYVNHVLENHSIKFKLY

NCBI Accession YP_004821544.1
Location 1089-1493
Gene Name AC2
Protein Name transactivator protein
Coding Region ATGCTGTCTTCATCACACTCGACTCCCCCCTGTATCAAGAAGAGACACAGGCAGGCCAAGAAGAAACAGCCCAAGAGGAGAGCCATCAGGAGACGGCGTCTTGACTGGGGGTGCAATTGCACAGCTTACGTAGACATAAACTGCAGAGATCATGGATTCACGCACAGGGGAATTCATCAATGCGCGTCAAGCAGAGAATGGCGTTTATATCTGGGAGATAACAAATCCCCTGTATTTCAAGATTTCCCAGGTAGAGGACATGCCATACACCAGAACGAGGGTGTACCACCTCCAGATACGGTTCAACCACAACCTCAGGAGAGCGTTGCATCTCCACAAAGCCTACCTGAATTTCCAAGTCTGGACGACATCCCTGAAAGCTTCTGGGAAGACTTATTTGTTTAG
Protein Sequence MLSSSHSTPPCIKKRHRQAKKKQPKRRAIRRRRLDWGCNCTAYVDINCRDHGFTHRGIHQCASSREWRLYLGDNKSPVFQDFPGRGHAIHQNEGVPPPDTVQPQPQESVASPQSLPEFPSLDDIPESFWEDLFV

NCBI Accession YP_004821545.1
Location 1390-2490
Gene Name AC1
Protein Name REP protein
Coding Region ATGCCACCGCCTAAGAAATTTAGAATTAACTCCAAAAACTATTTCCTCACTTATCCCCAGTGCTCTCTTACTAAAGAAGAAGCACTTTCCCAATTACAAAACCTAAAAACCCCAGTAAACAAGAAGTTCATCAAAATCTGCAGAGAGCTTCACGAGAATGGGGAGCCTCATCTCCACATACTCATCCAGTTCGAGGGGAAGTACCAGTGCACGAATAACAGATTCTTCGATCTGGTCTCCCCAACCAGGTCAGCACATTTCCATCCAAACATTCAGGGAGMTAAATCAAGCTCGGACGTTAAGTCCTACATCGACAAGGATGGAGACACCATTGAATGGGGAGAATTCCAGATCGACGGCAGATCTGCAAGAGGAGGTCAGCAAACAGTCAACGATACATACGCAAAGGCGTTGAATGCTGCCTCTGCCGAGCAAGCTCTGCAAATCATAAAGGAAGAACAACCACAACATTTCTTCCTTCAACACCACAACCTGGTTGCTAACGCAACCAGAATATTCAAGAAGGCTCCGGAACCGTGGGTCCCTCCGTTTCGTCTCTCCTCTTTCACTAACGTTCCGGACGAGATGCAAGAGTGGGCCGATAGTTATTTTGGGCTTGATTCCGCTGCGCGGCCAAATCGTCCAATAAGTCTCATAGTTGAGGGTGATTCAAGAACAGGCAAGACGATGTGGGCTCGTGCCTTAGGCCCACATAATTATCTGAGTGGACACCTGGACTTCAACTCAAAGGTTTACTCGAACGAAGTGGAATATAACGTCATTGATGACGTCTCTCCGCAATACTTAAAGTTGAAGCACTGGAAAGAGCTCCTTGGGGCCCAAAAAGACTGGCAGTCAAATTGCAAGTACGGGAAGCCAGTTCAAATTAAAGGAGGGATCCCATCAATCGTGCTCTGCAATCCAGGTGAGGGTGCCAGCTATAAAGATTTCCTGAACAAAGAGGAAAACGCATCCCTCAGGAACTGGACACTCAAGAATGCTGTCTTCATCACACTCGACTCCCCCCTGTATCAAGAAGAGACACAGGCAGGCCAAGAAGAAACAGCCCAAGAGGAGAGCCATCAGGAGACGGCGTCTTGA
Protein Sequence MPPPKKFRINSKNYFLTYPQCSLTKEEALSQLQNLKTPVNKKFIKICRELHENGEPHLHILIQFEGKYQCTNNRFFDLVSPTRSAHFHPNIQGXKSSSDVKSYIDKDGDTIEWGEFQIDGRSARGGQQTVNDTYAKALNAASAEQALQIIKEEQPQHFFLQHHNLVANATRIFKKAPEPWVPPFRLSSFTNVPDEMQEWADSYFGLDSAARPNRPISLIVEGDSRTGKTMWARALGPHNYLSGHLDFNSKVYSNEVEYNVIDDVSPQYLKLKHWKELLGAQKDWQSNCKYGKPVQIKGGIPSIVLCNPGEGASYKDFLNKEENASLRNWTLKNAVFITLDSPLYQEETQAGQEETAQEESHQETAS

References More References in PubMed

1

Nanopore sequencing of tomato mottle leaf distortion virus, a new bipartite begomovirus infecting tomato in Brazil.

Martins TP, et al.  Arch Virol. 2021 Nov;166(11):3217-3220. doi: 10.1007/s00705-021-05220-w. Epub 2021 Sep 8.

PMID: 34498121

2

Tomato chlorotic leaf distortion virus, a new bipartite begomovirus infecting Solanum lycopersicum and Capsicum chinense in Venezuela.

Zambrano K, et al.  Arch Virol. 2011 Dec;156(12):2263-6. doi: 10.1007/s00705-011-1093-x. Epub 2011 Aug 19.

PMID: 21853328

3

Spinach latent virus Infecting Tomato in Virginia, United States.

Vargas-Asencio J, et al.  Plant Dis. 2013 Dec;97(12):1663. doi: 10.1094/PDIS-05-13-0529-PDN.

PMID: 30716862

4

First Report of Tomato ringspot virus Infecting Pepper in Iran.

Sokhansanj Y, et al.  Plant Dis. 2012 Dec;96(12):1828. doi: 10.1094/PDIS-07-12-0664-PDN.

PMID: 30727266

5

First Report of Tomato mosaic virus on Hibiscus rosa-sinensis in China.

Huang JG, et al.  Plant Dis. 2004 Jun;88(6):683. doi: 10.1094/PDIS.2004.88.6.683C.

PMID: 30812606

6

First Report of Parietaria mottle virus on Tomato in Spain.

Aramburu J.  Plant Dis. 2001 Nov;85(11):1210. doi: 10.1094/PDIS.2001.85.11.1210C.

PMID: 30823185

7

First Report of Tomato spotted wilt virus on Brugmansia sp. in Serbia.

Nikolić D, et al.  Plant Dis. 2013 Jun;97(6):850. doi: 10.1094/PDIS-10-12-0937-PDN.

PMID: 30722590

8

First Report of Tomato severe rugose virus in Chili Pepper in Brazil.

Bezerra-Agasie IC, et al.  Plant Dis. 2006 Jan;90(1):114. doi: 10.1094/PD-90-0114C.

PMID: 30786504

9

Complete genome sequence of a new bipartite begomovirus infecting tomato in Brazil.

Rego-Machado CM, et al.  Arch Virol. 2019 Nov;164(11):2873-2875. doi: 10.1007/s00705-019-04380-0. Epub 2019 Aug 20.

PMID: 31432269

10

First Report of Tomato spotted wilt virus on Gerbera hybrida in Serbia.

Stanković I, et al.  Plant Dis. 2011 Feb;95(2):226. doi: 10.1094/PDIS-10-10-0704.

PMID: 30743419