Tobacco leaf curl Comoros virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_002986905.1
Isolate Comoros:Grande Comore, simboussa
Release date 2018/8/26
Submitter Lefeuvre,P., Martin,D.P., Hoareau,M., Naze,F., Becker,N., Delatte,H., Reynaud,B., Lett,J.M.
Host
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_038888
ACCGGATGGCCGCGCTCCCGAAAAAGCAGGTGGTCCCCACGCACTAGTTTTTGTCAGCCAATCAGAACCGCGCGTGAAAGCTTAGTTATTTATTTGTTGTCTTTATATACGTGGTCCCCAAGTACCTGTCCTTGTCAGTATGTGGGATCCACTGTTGAACGAGTTCCCAGACTCTGTTCACGGATTTCGTTGTATGCTTGCCGTCAAATATTTGCAGGCAGTTGAGCAAACGTACGAGCCCAATACATTGGGCCACGATCTAATACGTGATCTTATCTGTGTTATTAGGGCTCGAGACTATGTCGAAGCGACCCGGCGATATAATCATTTCCACGCCCGTCTCGAAGGTTCGTCGAAGGCTGAACTTCGACAGCCCATATACCAACCGTGCTGCTGTCCCCATTGTCCAAGGCATAAGCAAACGACGGTCATGGACTTACCGGCCCAGTTACCGAAAGCCCAGAATGTACCGGATGTACAGAAGTCCTGATGTTCCTCGTGGTTGTGAGGGTCCTTGTAAGATACAGTCATTTGATCAGCGTGATTCCGTTGTCCATACGGGTACTGTTAGATGTCTTAGTGATGTCACTAGGGGTGGTGGTCTTACCCATCGCACTGGTAAACGCTTTTGTATTAAGTCGATATATGTATTAGGTAAGATTTGGATGGACGAGAACGTGAAGAAGTCTAACCATACTAACACATGTATGTTTTGGGTAGTTAGAGATAGGCGCCCTTACGGACCTAGTCCCCAGGATTTCGGTCAGGTGTTTAATATGTTTGATAACGAGCCCAGTACTGCTACGGTTCAGAACGATAAGCGTGATCGTTATCAAGTTCTTCGTAGATTTCAGGTAACGGTAACGGGAGGTCCGTCTGGATGCAAGGAGGCTGCTATTGTTAAGAGATTTTTCCGTTTGAATCATCATGTGACGTACAATCATCAAGAGGCTGCGAAGTACGAGAATCATACGGAGAATGCTTTATTATTGTATATGGCATGTACACATGCCTCTAATCCTGTGTATGCAAGTCTGAAGATACGAATGTATTTCTATGATTCAGTGTCGAATTAATAAAATTTGAATTTTATTTCATGATTCTCCTGAACATGGAGTGTTTTTACAATAACATCGTACAATACATGATCAACTGCTCTAATTACATTGCTAATTGAAATTACACCCATGTTATCTAAATAATTTAAAACTTGAGTTTTAAATACCCTTAAGAAAAGACCAGTCTGAGGGCGTAAGCTCGTCCAGACCTTGAAGTTGAGAAAACATTTGTGAATCCCCAGTTCCTTCCTCAAATTGTGGTTGAATCTTATCTGGATCGATATGATATCGTGGGGCATGTTGAACGGCCGGTTGTCGTGGTTGATAATCTTGAAATATAGGGGATTTTGTATCTCCCAGATAAACACGCCACTCTGTGCTTGAGCTGCAGTGATGAGTTCCCCTGTGCGTAAATCCATGGTCGATGCAGCTGATGTGGAGATAGTATGAGCAGCCGCAGTCGAGATCTATCCTTCTACGCCTCACTGCCTTCTTCTTGGCTGTTTTGTGCTGGACTTTGATTGGCAGTTGAGTACAGTGGCTCGTAGATGGTGATGAAGGTCGCATTCTTTGTTGCCCAGGCTTTCAAGGGTGCATTCTTATCCTCGTCTAGATATTCCTTATAAGAGGATGTTGGTCCTGGATTGCAGAGGAAGATTGTGGGAATTCCGCCTTTAATTTGAATTGGTTTCCCGTACTTCGTGTTGCTTTGCCAGTCCCTTTGGGCCCCCATGAATTCCTTAAAGTGCTTTAAATAATGCGGGTCTACGTCATCAATGACGTTGTACCACGCATCATTACTGTACACCTTTGGGCTTAGATCCAGATGACCACACAAATAGTTGTGGGGTCCTAATGATCTGGCCCACATAGTCTTCCCCGTCCTACTATCACCCTCAATAACTATACTTACAGGTCTCCACGGCCGCGCAGCGGCATCCATGACGTTCTCGGAAACCCACTCTTCAAGTTCCTCCGGAACTTGAGTAAAAGAAGAAGATAAAAAAGGAGAAACATAAGGAGCTGGTGGCTCCTGAAAAATCCTATCTAAATTACTATTTAAATTATGAAATTGTAAAACAAAATCTTTGGGGGCTAATTCCTTAATGACTCTAAGAGCCTCTGACTTACTGCCTGCGTTAAGAGCTGCGGCGTAAGCGTCGTTGGCCGATTGTTGTCCCCCCCTTGCAGATCGTCCATCGATCTGAAACTCTCCCCATTCGAGGGTGTCTCCGTCTTTGTCCAGATAGGACTTGACGTCGGAGCTGGACTTAGCTCCTTGTATGTTGGGGTGGAAACTGGTGCTACTGCTTGGGTGTACGCAATCGAAGAGGCGATTGTTGGTGCACGTGAGTTTTCCCTCGAATTGAATAAGGGCATGCAGATGAGGTTCCCCATTCTGGTGGTGTTCAAGGCAGATTTTGATATATTTAGGGTTTGTTGGAAGTGAAAGGTTTTGTAAGAAGGATAGAAGGTGTTCTTTGCTAAGAGAACACTTTGGATAAGTGAGGAAAATGTTTTTGGCTTGAATTTTAAAACGAGGAGTTCTCATGTTGACTTGGTCAATTGGAGACACTCGGCTGAACTCTCTCTAATGTATTGGAGACAATATATAGTGTCTCCAAATGGCATTTCGGAAATAAAGCTCATTGTAATTTGAATTTTGAATTTCCAAAAGCGGCCATCCGTATAATATT

Gene Information

NCBI Accession YP_009508148.1
Location 140-490
Gene Name v2
Protein Name V2 protein
Coding Region ATGTGGGATCCACTGTTGAACGAGTTCCCAGACTCTGTTCACGGATTTCGTTGTATGCTTGCCGTCAAATATTTGCAGGCAGTTGAGCAAACGTACGAGCCCAATACATTGGGCCACGATCTAATACGTGATCTTATCTGTGTTATTAGGGCTCGAGACTATGTCGAAGCGACCCGGCGATATAATCATTTCCACGCCCGTCTCGAAGGTTCGTCGAAGGCTGAACTTCGACAGCCCATATACCAACCGTGCTGCTGTCCCCATTGTCCAAGGCATAAGCAAACGACGGTCATGGACTTACCGGCCCAGTTACCGAAAGCCCAGAATGTACCGGATGTACAGAAGTCCTGA
Protein Sequence MWDPLLNEFPDSVHGFRCMLAVKYLQAVEQTYEPNTLGHDLIRDLICVIRARDYVEATRRYNHFHARLEGSSKAELRQPIYQPCCCPHCPRHKQTTVMDLPAQLPKAQNVPDVQKS

NCBI Accession YP_009508149.1
Location 300-1076
Gene Name cp
Protein Name coat protein
Coding Region ATGTCGAAGCGACCCGGCGATATAATCATTTCCACGCCCGTCTCGAAGGTTCGTCGAAGGCTGAACTTCGACAGCCCATATACCAACCGTGCTGCTGTCCCCATTGTCCAAGGCATAAGCAAACGACGGTCATGGACTTACCGGCCCAGTTACCGAAAGCCCAGAATGTACCGGATGTACAGAAGTCCTGATGTTCCTCGTGGTTGTGAGGGTCCTTGTAAGATACAGTCATTTGATCAGCGTGATTCCGTTGTCCATACGGGTACTGTTAGATGTCTTAGTGATGTCACTAGGGGTGGTGGTCTTACCCATCGCACTGGTAAACGCTTTTGTATTAAGTCGATATATGTATTAGGTAAGATTTGGATGGACGAGAACGTGAAGAAGTCTAACCATACTAACACATGTATGTTTTGGGTAGTTAGAGATAGGCGCCCTTACGGACCTAGTCCCCAGGATTTCGGTCAGGTGTTTAATATGTTTGATAACGAGCCCAGTACTGCTACGGTTCAGAACGATAAGCGTGATCGTTATCAAGTTCTTCGTAGATTTCAGGTAACGGTAACGGGAGGTCCGTCTGGATGCAAGGAGGCTGCTATTGTTAAGAGATTTTTCCGTTTGAATCATCATGTGACGTACAATCATCAAGAGGCTGCGAAGTACGAGAATCATACGGAGAATGCTTTATTATTGTATATGGCATGTACACATGCCTCTAATCCTGTGTATGCAAGTCTGAAGATACGAATGTATTTCTATGATTCAGTGTCGAATTAA
Protein Sequence MSKRPGDIIISTPVSKVRRRLNFDSPYTNRAAVPIVQGISKRRSWTYRPSYRKPRMYRMYRSPDVPRGCEGPCKIQSFDQRDSVVHTGTVRCLSDVTRGGGLTHRTGKRFCIKSIYVLGKIWMDENVKKSNHTNTCMFWVVRDRRPYGPSPQDFGQVFNMFDNEPSTATVQNDKRDRYQVLRRFQVTVTGGPSGCKEAAIVKRFFRLNHHVTYNHQEAAKYENHTENALLLYMACTHASNPVYASLKIRMYFYDSVSN

NCBI Accession YP_009508150.1
Location 1073-1477
Gene Name c3
Protein Name C3 protein
Coding Region ATGGATTTACGCACAGGGGAACTCATCACTGCAGCTCAAGCACAGAGTGGCGTGTTTATCTGGGAGATACAAAATCCCCTATATTTCAAGATTATCAACCACGACAACCGGCCGTTCAACATGCCCCACGATATCATATCGATCCAGATAAGATTCAACCACAATTTGAGGAAGGAACTGGGGATTCACAAATGTTTTCTCAACTTCAAGGTCTGGACGAGCTTACGCCCTCAGACTGGTCTTTTCTTAAGGGTATTTAAAACTCAAGTTTTAAATTATTTAGATAACATGGGTGTAATTTCAATTAGCAATGTAATTAGAGCAGTTGATCATGTATTGTACGATGTTATTGTAAAAACACTCCATGTTCAGGAGAATCATGAAATAAAATTCAAATTTTATTAA
Protein Sequence MDLRTGELITAAQAQSGVFIWEIQNPLYFKIINHDNRPFNMPHDIISIQIRFNHNLRKELGIHKCFLNFKVWTSLRPQTGLFLRVFKTQVLNYLDNMGVISISNVIRAVDHVLYDVIVKTLHVQENHEIKFKFY

NCBI Accession YP_009508151.1
Location 1218-1625
Gene Name c2
Protein Name C2 protein
Coding Region ATGCGACCTTCATCACCATCTACGAGCCACTGTACTCAACTGCCAATCAAAGTCCAGCACAAAACAGCCAAGAAGAAGGCAGTGAGGCGTAGAAGGATAGATCTCGACTGCGGCTGCTCATACTATCTCCACATCAGCTGCATCGACCATGGATTTACGCACAGGGGAACTCATCACTGCAGCTCAAGCACAGAGTGGCGTGTTTATCTGGGAGATACAAAATCCCCTATATTTCAAGATTATCAACCACGACAACCGGCCGTTCAACATGCCCCACGATATCATATCGATCCAGATAAGATTCAACCACAATTTGAGGAAGGAACTGGGGATTCACAAATGTTTTCTCAACTTCAAGGTCTGGACGAGCTTACGCCCTCAGACTGGTCTTTTCTTAAGGGTATTTAA
Protein Sequence MRPSSPSTSHCTQLPIKVQHKTAKKKAVRRRRIDLDCGCSYYLHISCIDHGFTHRGTHHCSSSTEWRVYLGDTKSPIFQDYQPRQPAVQHAPRYHIDPDKIQPQFEEGTGDSQMFSQLQGLDELTPSDWSFLKGI

NCBI Accession YP_009508152.1
Location 1534-2610
Gene Name rep
Protein Name replication associated protein
Coding Region ATGAGAACTCCTCGTTTTAAAATTCAAGCCAAAAACATTTTCCTCACTTATCCAAAGTGTTCTCTTAGCAAAGAACACCTTCTATCCTTCTTACAAAACCTTTCACTTCCAACAAACCCTAAATATATCAAAATCTGCCTTGAACACCACCAGAATGGGGAACCTCATCTGCATGCCCTTATTCAATTCGAGGGAAAACTCACGTGCACCAACAATCGCCTCTTCGATTGCGTACACCCAAGCAGTAGCACCAGTTTCCACCCCAACATACAAGGAGCTAAGTCCAGCTCCGACGTCAAGTCCTATCTGGACAAAGACGGAGACACCCTCGAATGGGGAGAGTTTCAGATCGATGGACGATCTGCAAGGGGGGGACAACAATCGGCCAACGACGCTTACGCCGCAGCTCTTAACGCAGGCAGTAAGTCAGAGGCTCTTAGAGTCATTAAGGAATTAGCCCCCAAAGATTTTGTTTTACAATTTCATAATTTAAATAGTAATTTAGATAGGATTTTTCAGGAGCCACCAGCTCCTTATGTTTCTCCTTTTTTATCTTCTTCTTTTACTCAAGTTCCGGAGGAACTTGAAGAGTGGGTTTCCGAGAACGTCATGGATGCCGCTGCGCGGCCGTGGAGACCTGTAAGTATAGTTATTGAGGGTGATAGTAGGACGGGGAAGACTATGTGGGCCAGATCATTAGGACCCCACAACTATTTGTGTGGTCATCTGGATCTAAGCCCAAAGGTGTACAGTAATGATGCGTGGTACAACGTCATTGATGACGTAGACCCGCATTATTTAAAGCACTTTAAGGAATTCATGGGGGCCCAAAGGGACTGGCAAAGCAACACGAAGTACGGGAAACCAATTCAAATTAAAGGCGGAATTCCCACAATCTTCCTCTGCAATCCAGGACCAACATCCTCTTATAAGGAATATCTAGACGAGGATAAGAATGCACCCTTGAAAGCCTGGGCAACAAAGAATGCGACCTTCATCACCATCTACGAGCCACTGTACTCAACTGCCAATCAAAGTCCAGCACAAAACAGCCAAGAAGAAGGCAGTGAGGCGTAG
Protein Sequence MRTPRFKIQAKNIFLTYPKCSLSKEHLLSFLQNLSLPTNPKYIKICLEHHQNGEPHLHALIQFEGKLTCTNNRLFDCVHPSSSTSFHPNIQGAKSSSDVKSYLDKDGDTLEWGEFQIDGRSARGGQQSANDAYAAALNAGSKSEALRVIKELAPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFLSSSFTQVPEELEEWVSENVMDAAARPWRPVSIVIEGDSRTGKTMWARSLGPHNYLCGHLDLSPKVYSNDAWYNVIDDVDPHYLKHFKEFMGAQRDWQSNTKYGKPIQIKGGIPTIFLCNPGPTSSYKEYLDEDKNAPLKAWATKNATFITIYEPLYSTANQSPAQNSQEEGSEA

NCBI Accession YP_009508153.1
Location 2154-2456
Gene Name c4
Protein Name C4 protein
Coding Region ATGGGGAACCTCATCTGCATGCCCTTATTCAATTCGAGGGAAAACTCACGTGCACCAACAATCGCCTCTTCGATTGCGTACACCCAAGCAGTAGCACCAGTTTCCACCCCAACATACAAGGAGCTAAGTCCAGCTCCGACGTCAAGTCCTATCTGGACAAAGACGGAGACACCCTCGAATGGGGAGAGTTTCAGATCGATGGACGATCTGCAAGGGGGGGACAACAATCGGCCAACGACGCTTACGCCGCAGCTCTTAACGCAGGCAGTAAGTCAGAGGCTCTTAGAGTCATTAAGGAATTAG
Protein Sequence MGNLICMPLFNSRENSRAPTIASSIAYTQAVAPVSTPTYKELSPAPTSSPIWTKTETPSNGESFRSMDDLQGGDNNRPTTLTPQLLTQAVSQRLLESLRN

References More References in PubMed

1

Differential disease phenotype of begomoviruses associated with tobacco leaf curl disease in Comoros.

Thierry M, et al.  Arch Virol. 2012 Mar;157(3):545-50. doi: 10.1007/s00705-011-1199-1. Epub 2011 Dec 21.

PMID: 22187103

2

Complete genome sequence of a new bipartite begomovirus infecting cotton in the Republic of Benin in West Africa.

Leke WN, et al.  Arch Virol. 2016 Aug;161(8):2329-33. doi: 10.1007/s00705-016-2894-8. Epub 2016 May 25.

PMID: 27224982