South African cassava mosaic virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_000838365.1
Release date 2015/2/12
Submitter Berrie,L.C., Rybicki,E.P., Rey,M.E., Rey,M.E.C.
Vector
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_003803
ACCGGATGGCCGCGCCCGACAAAGTAGGTGGACCCCATTGGATGACCGCGCCCGTAAAAGAAAGTGGTCCCCACGCACGTGTTGCTGTCGGCCAGTCATATTCACGCGTGAAAGCCTAGATATTTGTTTTATGTCGTTATAGACTTCGTCGCGAAGTAGTGGAGCGTGTCAACATGTGGGATCCATTGTTGAATGAGTTCCCCGAGTCTGTGCACGGTTTTCGCTGTATGCTTGCTATTAAATATTTGCAGGCCTTGGAGGAAACCTACGAGCCCAATACTTTGGGCCACGATCTAGTCCGTGATCTCATCGGTGTGATCCGAGCCCGTGATTATGTCGAAGCGTCCCGCCGATATAATCATTTCCACTCCCGTCTCGAAGGTGCGTCGAAGGCTGAACTTCGACAGCCCGTTCAGCAGCCGTGCTGCTGTCCCCATTGTCCAAGGCACAAACAAGCGTCGATCATGGACGTTCCGGCCCATGTACCGAAAGCCCAGAATGTACAGAATGTTCAAAAGCCCTGATGTTCCGCGTGGCTGTGAAGGCCCATGTAAGGTTCAATCTTATGAACAGCGAGATGACGTTAAGCATACTGGCAGTGTTCGTTGTGTTAGTGATGTCACGCGTGGTTCGGGAATTACACATAGAGTAGGTAAAAGGTTCTGTATCAAGTCTATATATGTGTTAGGTAAGATATGGATGGATGAAAACATCAAGAAGCAGAACCATACAAACCAGGTCATGTTCTTCTTAGTCCGTGACAGAAGGCCCTATGGCAATAGCCCCATGGACTTTGGACAGGTTTTTAATATGTTTGATAATGAGCCCAGTACAGCCACTGTGAAGAACGATCTTAGGGATAGGTATCGAGTTATGCGGAAGTTTCATGCCACCGTTGTTGGGGGTCCTTCTGGAATGAAGGAGCAGGCTTTGGTGAGGAGATTTTTTAGGATAAATAATCATGTTGTGTATAATCACCAGGAGGCAGCTAAGTATGAGAATCATACAGAGAATGCGTTATTGTTGTATATGGCATGTACGCATGCCTCTAATCCAGTGTATGCTACGCTTAAAATACGCATCTATTTTTATGATGCAGTAACAAATTAATAAAGGTTGAATTTTATTGCATGTTGCTCCGTAACTTGGAGTGTGTTTAGTAATACATCGTACAGAACATGATCAACAGCTCTGAGTACAGTGTTAATGGAAATAACGCCTATCATATTTAAATACTTGAGCACTTGATATTTAAATACTCTTAAGAAAAGACCAGTCGGAGGCCGTAAGGTCGTCCAGACCTTGAAGTTGAGAAAACACTTGTGAATCCCCAATGCCTTCCTGATGTTGTGGTTGAACCGTATCTGGAGGGTGATGATGTCGTGGTTCATGTTCCCTGGCCGCTTGTCGTGGTTGGTGATGTCGAAATAGAGGGGATTTGTTATTTCCCAGGTAAAAACGCCATTCTTTGCTTGAGGCGCAGTGATGAGTTCCCCTGTGCGAGAATCCATGGTTGATGCAGTCGATATGGAGATAGAACGAGCAGCCGCATTCGAGGTCTACCCTCCTACGTCTGAGGGCCCTAGTCTTCGCGGTGCGGTGTTGGACTTTGATGGGCACTTGAGAACAATGGCTCGTGGAGGGTGATGAAGGTTGCATTCTTTAAAGCCCAGGCTTTAAGGGACTGGTTCTTTTCCTCGTCCAGAAACTCTTTATATGATGATGTCGGTCCTGGATTGCATAGGAAGATAGTGGGAATGCCGCCTTTAATTTGAATCGGCTTCCCGTACTTGGTATTGCTTTGCCAGTCCCTTTGGGCCCCCATGAATTCTTTGAAGTGCTTGAGGTAATGGGGGTCGACGTCATCAATGACGTTGTACCATGCGTCGTTGCTGTAAACCTTTGGACTGAGATCCAAATGTCCACATAAGTAGTTGTGTGGTCCCAGAGATCGGGCCCACATCGTCTTCCCTGTCCTACTATCGCCCTCGATGACGATACTACTCGGTCTCCATGGCCGCGCAGCGAAACCCATCACGTTCTCGGAAACCCAGTCTTCAAGTTCCTCAGGAACATGAGTGAAAGAAGAAGAAAGAAAGGGAGAAATATAAGGAATCGGAGGCTCCTGAAAAATCCTATCTAAATTGCTATTTAAATTATGAAACTGTAAAACAAAATCCTTTGGGGCTAGTTCCCGGATTACATTAAGAGCCTCTGTTTTACTTGCTGCGTTAAGAGCCTTGGCGTAAGCGTCATTGGCGGATTGTTGTCCGCCGCGAGCAGATCGTCCGTCGATCTGAAACTCGCCCCATTGGATGGTGTCTCCGTCCTTGTCCAAATAGGACTTGACGTCAGAACTGGATTTAGCTCCCTGAATGTTTGGATGGAAATGTGTTGACCTGGAAGGGGATATGAGGTCGAAGAATCGTTGGTTGGTACAATTGTACTTGCCCTCGAACTGAATGAGGGCATGCAAATGAGGTTCCCCATTTTCATGGAGTTCTCTGCAGATCTTGATGAACAATTTATTTGTTGGGGTTTGGAGTTGTCGGAGTTGATCTAATGCCGCTTCTTTCGAGAGAGTGCATTTCGGATACGTGAGGAAATAATTTTTGGCTTTTATGCTAAAACGACCAGCCCTCGGCATTTTCGCTGTCGTATAGCAATCGGGGGGCACTCAAAGTTCCTAGCAATCGGGGGAATGGGGGGCAATTTATATGATGCCCCCCAAATGGCATATGTGTAATTTTGTGATGAAATTTGAATTTCGAACGTGGAAAGCGGCCATCCGTCTAATATT

NC_003804
ACCGGATGGCCGCGCCCGAAAAAGCAGATGGACCCCACAATGGTCCCCACGCACTAAATAATGTCAGCCAATCAATTGCAAGACTGGAAGACTCGGTAGTGACGCATGGAGTATTAAGTGGTTTCTGCACTAATTTGGACAGGCAATTTTATTGCTATGTGTGTATCATATTTTTATAGGTGTGCTACTGGCCAATCAAAGTTAGGTGATGGGGCCTACCATAAAAACGCAAAATATAGGTACGTATGTACATATTGATTATATTTTTAGGTGCGGATATAAGAGGCGCCACGTGTTTACAATGGATATGGATTGTCCTATAAATATTGTGCATGTCTCCCGTTCGTTAATGCAAGATGTATTCAGTTTACAGACGTGGGTATAAGACTCCGTATAGGAGTCCGTATGGCGCTCGTGTAACACCATATGTATATCGTAAGACCTCTGGTAAACAGACGTCTAAATCTCGTGTACCGCGAAAGTTGGTGTATGAATCGCCAAAAGGTCTATATACGCGACGCTCATTGGAGGATATCCATAATGGGGCTTCCTTGAAGTTGTCTCAACAGGGGGATTATACGTCCTACGTGTCACTCCCTTGTCGAGGTATCGAAGGTAATGGGGGTAGGTCTGTTGATCACATAAAATTATTAAACTTGAGGGTTTCTGGGACCGTCAACGTCAGTCAAGTCGGTGGTGATGATAATATGGGAGAGAGAACGACCATGAGGGGTATCTTCTTCATGGCTTGTCTTGTTGATAAGAAACCTTTCGTTCCAGAGGGGGTCAGTATATTGCCGACGTTCAATGAGTTGTTCGGGGAATATGAATCCGTGTACGGCATGCCTAGGTTGAAGGAAAACGTCCGTCACCGGTATCGCGTTATTGGGACATCGAAATTATATATAACGACGGATGAAGATCACATCCAAAAGCCCTTTAGTTTACGTCGAAGACTAAGTGGAGGGAAATATCCTATTTGGTCGTCGTTCAAGGATGTGGATAATAGTAGTACAGGTGGTAACTATAAAAATATAAATAAGAACGCTATACTAGTGAGTTATGTGTGGGTATCGCTATGTCGGACCACGTGTGATGTGTATTCGCAGTTTGTACTGAATTACGTCGGTTGATAATAAAAAGAGATAAGTGTGTTGACAGGAATTATGTTTGAACTAATGAAACATGAGATGAACATTAATTGAAAGCATATATAGTTTGATTATGCTTTTAAGCAAATATGGTACATATCAATTGTTTATTACAATTGCCTTGGTGCGTCGGATTTTATTTTGTAGAGACACTTGTTTATGGTACTCTCAAGCAGTGTCTCGAGGTCCTTTCTGGAGACGGAGTCGGATTGGGCCTGTGATATCGAGTCCCCTGGGTCCAAATCGGGTGTGTGTAATCTGTGTAGTTTCTGGTAAGGATATTCTGTGGAGTCGTTGTCTAAGTCCGTTGGTGTTGTCGATGGGTCCATTCTCATGGACTGTGAACGAAAGTGTTCCAGCTGTGCTGGGCCTAATGAGCTTGGTAGCCCAATCTGAGACCTTGTGGCCCATGTTTCGCCTGGATGGATGGTGATGGGCCTGTGGGTTATGGGTTGTTGACTACGAGCAGTTGGAGTGGGATTTAATAATCGTCGTCTTGTTTCTCCTTTTTCCACGGACCAGAAGTCTATGCAGTCTTTTGTGTATCCCTTGGATAAGATGTTAATTGTTGGGGGTTTGAAACGTATGTCCGTGGAATGTTTGGCCGATGATAATCGGAGCTTGGCCTTGATGGATGCGAATTTCACGCCTTCTATGACGTTTGAGTCTTCGACTCTGTACATGATTCTCCAAGGGGAAGGTTCAGAAATCGAAAAATATGTAGAAGAGAAGTAGTGGAGGTCCACGTTGCAAGCGATGGGGAAAGTGAATGCTGCCTGAGCTGCGTCGTCAAGGCTGACGCGATTGTCTCTGATTTCTACGATAACCGACCCAGTTGCGTTAAATGGGACCTGGTTTCGGTATTCAATTATAATGTGGTCGATTTTCATACATCGGCCTTTGAGTCGCATGGTAGCCTGCTCGAATGAGCCTGGGAATTGGAGATTGATTGGTGCAGCATCGTTTGTTAATGCGTACTCGGTGCGTTTGCTGTTGATGTAATTATTGTCTGTGACGGTAAATTGGGCGTCCATTCTATGAAGCAAAAAAACAAAGGTTAGTAAACGGAGAGACGAGAGGTATAAAAGTCAGAACAAAGTTGAAAAAATATCGTGTAGACATGGAAGCATATATGCATTTGTTATATAGAATAACACACGAGATCAGAACAAGGATCATATATGTTGAACCGGCCGCGCAGCGGATAGGAAGTCAGATAAATCGGCGAACAAAGAAAACAGTCGAATGGGGTGATGTGATGTAAACCACTTACAGAAGCGCCGAAGAAGCAGTTCGAAGTGAATTCCTGTGCTAATTAGGCGAAGACAAAGAAATAAAAGTAGAACTTATTGCGAAAAAAGGAAAGGGAGCAGATGTTACGCGTGGTGTCGTGAAATGATATGTTATTAGGTGTTTATATAGGCGTGAATAAGCTACACGTGGTAGAGAGAGAAAGAAGAGAGAGGCGAGAGCAATCGGGGGGCACTCAAAGTTCCTAGCAATCGGGGGAATGGGGGGCAATTTATATGATGCCCCCCAAATGGCATTTGTGTAATTTCTTAATGAAATTTGAATTGCGAACGTGGAAAGCGGCCATCCGTATAATATT

Gene Information

NCBI Accession NP_620661.1
Location 174-524
Gene Name AV2
Protein Name AV2
Coding Region ATGTGGGATCCATTGTTGAATGAGTTCCCCGAGTCTGTGCACGGTTTTCGCTGTATGCTTGCTATTAAATATTTGCAGGCCTTGGAGGAAACCTACGAGCCCAATACTTTGGGCCACGATCTAGTCCGTGATCTCATCGGTGTGATCCGAGCCCGTGATTATGTCGAAGCGTCCCGCCGATATAATCATTTCCACTCCCGTCTCGAAGGTGCGTCGAAGGCTGAACTTCGACAGCCCGTTCAGCAGCCGTGCTGCTGTCCCCATTGTCCAAGGCACAAACAAGCGTCGATCATGGACGTTCCGGCCCATGTACCGAAAGCCCAGAATGTACAGAATGTTCAAAAGCCCTGA
Protein Sequence MWDPLLNEFPESVHGFRCMLAIKYLQALEETYEPNTLGHDLVRDLIGVIRARDYVEASRRYNHFHSRLEGASKAELRQPVQQPCCCPHCPRHKQASIMDVPAHVPKAQNVQNVQKP

NCBI Accession NP_620662.1
Location 334-1110
Gene Name AV1
Protein Name coat protein
Coding Region ATGTCGAAGCGTCCCGCCGATATAATCATTTCCACTCCCGTCTCGAAGGTGCGTCGAAGGCTGAACTTCGACAGCCCGTTCAGCAGCCGTGCTGCTGTCCCCATTGTCCAAGGCACAAACAAGCGTCGATCATGGACGTTCCGGCCCATGTACCGAAAGCCCAGAATGTACAGAATGTTCAAAAGCCCTGATGTTCCGCGTGGCTGTGAAGGCCCATGTAAGGTTCAATCTTATGAACAGCGAGATGACGTTAAGCATACTGGCAGTGTTCGTTGTGTTAGTGATGTCACGCGTGGTTCGGGAATTACACATAGAGTAGGTAAAAGGTTCTGTATCAAGTCTATATATGTGTTAGGTAAGATATGGATGGATGAAAACATCAAGAAGCAGAACCATACAAACCAGGTCATGTTCTTCTTAGTCCGTGACAGAAGGCCCTATGGCAATAGCCCCATGGACTTTGGACAGGTTTTTAATATGTTTGATAATGAGCCCAGTACAGCCACTGTGAAGAACGATCTTAGGGATAGGTATCGAGTTATGCGGAAGTTTCATGCCACCGTTGTTGGGGGTCCTTCTGGAATGAAGGAGCAGGCTTTGGTGAGGAGATTTTTTAGGATAAATAATCATGTTGTGTATAATCACCAGGAGGCAGCTAAGTATGAGAATCATACAGAGAATGCGTTATTGTTGTATATGGCATGTACGCATGCCTCTAATCCAGTGTATGCTACGCTTAAAATACGCATCTATTTTTATGATGCAGTAACAAATTAA
Protein Sequence MSKRPADIIISTPVSKVRRRLNFDSPFSSRAAVPIVQGTNKRRSWTFRPMYRKPRMYRMFKSPDVPRGCEGPCKVQSYEQRDDVKHTGSVRCVSDVTRGSGITHRVGKRFCIKSIYVLGKIWMDENIKKQNHTNQVMFFLVRDRRPYGNSPMDFGQVFNMFDNEPSTATVKNDLRDRYRVMRKFHATVVGGPSGMKEQALVRRFFRINNHVVYNHQEAAKYENHTENALLLYMACTHASNPVYATLKIRIYFYDAVTN

NCBI Accession NP_620663.1
Location 1107-1511
Gene Name AC3
Protein Name AC3
Coding Region ATGGATTCTCGCACAGGGGAACTCATCACTGCGCCTCAAGCAAAGAATGGCGTTTTTACCTGGGAAATAACAAATCCCCTCTATTTCGACATCACCAACCACGACAAGCGGCCAGGGAACATGAACCACGACATCATCACCCTCCAGATACGGTTCAACCACAACATCAGGAAGGCATTGGGGATTCACAAGTGTTTTCTCAACTTCAAGGTCTGGACGACCTTACGGCCTCCGACTGGTCTTTTCTTAAGAGTATTTAAATATCAAGTGCTCAAGTATTTAAATATGATAGGCGTTATTTCCATTAACACTGTACTCAGAGCTGTTGATCATGTTCTGTACGATGTATTACTAAACACACTCCAAGTTACGGAGCAACATGCAATAAAATTCAACCTTTATTAA
Protein Sequence MDSRTGELITAPQAKNGVFTWEITNPLYFDITNHDKRPGNMNHDIITLQIRFNHNIRKALGIHKCFLNFKVWTTLRPPTGLFLRVFKYQVLKYLNMIGVISINTVLRAVDHVLYDVLLNTLQVTEQHAIKFNLY

NCBI Accession NP_620664.1
Location 1252-1659
Gene Name AC2
Protein Name AC2
Coding Region ATGCAACCTTCATCACCCTCCACGAGCCATTGTTCTCAAGTGCCCATCAAAGTCCAACACCGCACCGCGAAGACTAGGGCCCTCAGACGTAGGAGGGTAGACCTCGAATGCGGCTGCTCGTTCTATCTCCATATCGACTGCATCAACCATGGATTCTCGCACAGGGGAACTCATCACTGCGCCTCAAGCAAAGAATGGCGTTTTTACCTGGGAAATAACAAATCCCCTCTATTTCGACATCACCAACCACGACAAGCGGCCAGGGAACATGAACCACGACATCATCACCCTCCAGATACGGTTCAACCACAACATCAGGAAGGCATTGGGGATTCACAAGTGTTTTCTCAACTTCAAGGTCTGGACGACCTTACGGCCTCCGACTGGTCTTTTCTTAAGAGTATTTAA
Protein Sequence MQPSSPSTSHCSQVPIKVQHRTAKTRALRRRRVDLECGCSFYLHIDCINHGFSHRGTHHCASSKEWRFYLGNNKSPLFRHHQPRQAAREHEPRHHHPPDTVQPQHQEGIGDSQVFSQLQGLDDLTASDWSFLKSI

NCBI Accession NP_620665.1
Location 1583-2647
Gene Name AC1
Protein Name replicase
Coding Region ATGCCGAGGGCTGGTCGTTTTAGCATAAAAGCCAAAAATTATTTCCTCACGTATCCGAAATGCACTCTCTCGAAAGAAGCGGCATTAGATCAACTCCGACAACTCCAAACCCCAACAAATAAATTGTTCATCAAGATCTGCAGAGAACTCCATGAAAATGGGGAACCTCATTTGCATGCCCTCATTCAGTTCGAGGGCAAGTACAATTGTACCAACCAACGATTCTTCGACCTCATATCCCCTTCCAGGTCAACACATTTCCATCCAAACATTCAGGGAGCTAAATCCAGTTCTGACGTCAAGTCCTATTTGGACAAGGACGGAGACACCATCCAATGGGGCGAGTTTCAGATCGACGGACGATCTGCTCGCGGCGGACAACAATCCGCCAATGACGCTTACGCCAAGGCTCTTAACGCAGCAAGTAAAACAGAGGCTCTTAATGTAATCCGGGAACTAGCCCCAAAGGATTTTGTTTTACAGTTTCATAATTTAAATAGCAATTTAGATAGGATTTTTCAGGAGCCTCCGATTCCTTATATTTCTCCCTTTCTTTCTTCTTCTTTCACTCATGTTCCTGAGGAACTTGAAGACTGGGTTTCCGAGAACGTGATGGGTTTCGCTGCGCGGCCATGGAGACCGAGTAGTATCGTCATCGAGGGCGATAGTAGGACAGGGAAGACGATGTGGGCCCGATCTCTGGGACCACACAACTACTTATGTGGACATTTGGATCTCAGTCCAAAGGTTTACAGCAACGACGCATGGTACAACGTCATTGATGACGTCGACCCCCATTACCTCAAGCACTTCAAAGAATTCATGGGGGCCCAAAGGGACTGGCAAAGCAATACCAAGTACGGGAAGCCGATTCAAATTAAAGGCGGCATTCCCACTATCTTCCTATGCAATCCAGGACCGACATCATCATATAAAGAGTTTCTGGACGAGGAAAAGAACCAGTCCCTTAAAGCCTGGGCTTTAAAGAATGCAACCTTCATCACCCTCCACGAGCCATTGTTCTCAAGTGCCCATCAAAGTCCAACACCGCACCGCGAAGACTAG
Protein Sequence MPRAGRFSIKAKNYFLTYPKCTLSKEAALDQLRQLQTPTNKLFIKICRELHENGEPHLHALIQFEGKYNCTNQRFFDLISPSRSTHFHPNIQGAKSSSDVKSYLDKDGDTIQWGEFQIDGRSARGGQQSANDAYAKALNAASKTEALNVIRELAPKDFVLQFHNLNSNLDRIFQEPPIPYISPFLSSSFTHVPEELEDWVSENVMGFAARPWRPSSIVIEGDSRTGKTMWARSLGPHNYLCGHLDLSPKVYSNDAWYNVIDDVDPHYLKHFKEFMGAQRDWQSNTKYGKPIQIKGGIPTIFLCNPGPTSSYKEFLDEEKNQSLKAWALKNATFITLHEPLFSSAHQSPTPHRED

NCBI Accession NP_620666.1
Location 2200-2496
Gene Name AC4
Protein Name AC4
Coding Region ATGAAAATGGGGAACCTCATTTGCATGCCCTCATTCAGTTCGAGGGCAAGTACAATTGTACCAACCAACGATTCTTCGACCTCATATCCCCTTCCAGGTCAACACATTTCCATCCAAACATTCAGGGAGCTAAATCCAGTTCTGACGTCAAGTCCTATTTGGACAAGGACGGAGACACCATCCAATGGGGCGAGTTTCAGATCGACGGACGATCTGCTCGCGGCGGACAACAATCCGCCAATGACGCTTACGCCAAGGCTCTTAACGCAGCAAGTAAAACAGAGGCTCTTAATGTAA
Protein Sequence MKMGNLICMPSFSSRASTIVPTNDSSTSYPLPGQHISIQTFRELNPVLTSSPIWTRTETPSNGASFRSTDDLLAADNNPPMTLTPRLLTQQVKQRLLM

NCBI Accession NP_620667.1
Location 357-1133
Gene Name BV1
Protein Name BV1
Coding Region ATGTATTCAGTTTACAGACGTGGGTATAAGACTCCGTATAGGAGTCCGTATGGCGCTCGTGTAACACCATATGTATATCGTAAGACCTCTGGTAAACAGACGTCTAAATCTCGTGTACCGCGAAAGTTGGTGTATGAATCGCCAAAAGGTCTATATACGCGACGCTCATTGGAGGATATCCATAATGGGGCTTCCTTGAAGTTGTCTCAACAGGGGGATTATACGTCCTACGTGTCACTCCCTTGTCGAGGTATCGAAGGTAATGGGGGTAGGTCTGTTGATCACATAAAATTATTAAACTTGAGGGTTTCTGGGACCGTCAACGTCAGTCAAGTCGGTGGTGATGATAATATGGGAGAGAGAACGACCATGAGGGGTATCTTCTTCATGGCTTGTCTTGTTGATAAGAAACCTTTCGTTCCAGAGGGGGTCAGTATATTGCCGACGTTCAATGAGTTGTTCGGGGAATATGAATCCGTGTACGGCATGCCTAGGTTGAAGGAAAACGTCCGTCACCGGTATCGCGTTATTGGGACATCGAAATTATATATAACGACGGATGAAGATCACATCCAAAAGCCCTTTAGTTTACGTCGAAGACTAAGTGGAGGGAAATATCCTATTTGGTCGTCGTTCAAGGATGTGGATAATAGTAGTACAGGTGGTAACTATAAAAATATAAATAAGAACGCTATACTAGTGAGTTATGTGTGGGTATCGCTATGTCGGACCACGTGTGATGTGTATTCGCAGTTTGTACTGAATTACGTCGGTTGA
Protein Sequence MYSVYRRGYKTPYRSPYGARVTPYVYRKTSGKQTSKSRVPRKLVYESPKGLYTRRSLEDIHNGASLKLSQQGDYTSYVSLPCRGIEGNGGRSVDHIKLLNLRVSGTVNVSQVGGDDNMGERTTMRGIFFMACLVDKKPFVPEGVSILPTFNELFGEYESVYGMPRLKENVRHRYRVIGTSKLYITTDEDHIQKPFSLRRRLSGGKYPIWSSFKDVDNSSTGGNYKNINKNAILVSYVWVSLCRTTCDVYSQFVLNYVG

NCBI Accession NP_620668.1
Location 1262-2185
Gene Name BC1
Protein Name BC1
Coding Region ATGGACGCCCAATTTACCGTCACAGACAATAATTACATCAACAGCAAACGCACCGAGTACGCATTAACAAACGATGCTGCACCAATCAATCTCCAATTCCCAGGCTCATTCGAGCAGGCTACCATGCGACTCAAAGGCCGATGTATGAAAATCGACCACATTATAATTGAATACCGAAACCAGGTCCCATTTAACGCAACTGGGTCGGTTATCGTAGAAATCAGAGACAATCGCGTCAGCCTTGACGACGCAGCTCAGGCAGCATTCACTTTCCCCATCGCTTGCAACGTGGACCTCCACTACTTCTCTTCTACATATTTTTCGATTTCTGAACCTTCCCCTTGGAGAATCATGTACAGAGTCGAAGACTCAAACGTCATAGAAGGCGTGAAATTCGCATCCATCAAGGCCAAGCTCCGATTATCATCGGCCAAACATTCCACGGACATACGTTTCAAACCCCCAACAATTAACATCTTATCCAAGGGATACACAAAAGACTGCATAGACTTCTGGTCCGTGGAAAAAGGAGAAACAAGACGACGATTATTAAATCCCACTCCAACTGCTCGTAGTCAACAACCCATAACCCACAGGCCCATCACCATCCATCCAGGCGAAACATGGGCCACAAGGTCTCAGATTGGGCTACCAAGCTCATTAGGCCCAGCACAGCTGGAACACTTTCGTTCACAGTCCATGAGAATGGACCCATCGACAACACCAACGGACTTAGACAACGACTCCACAGAATATCCTTACCAGAAACTACACAGATTACACACACCCGATTTGGACCCAGGGGACTCGATATCACAGGCCCAATCCGACTCCGTCTCCAGAAAGGACCTCGAGACACTGCTTGAGAGTACCATAAACAAGTGTCTCTACAAAATAAAATCCGACGCACCAAGGCAATTGTAA
Protein Sequence MDAQFTVTDNNYINSKRTEYALTNDAAPINLQFPGSFEQATMRLKGRCMKIDHIIIEYRNQVPFNATGSVIVEIRDNRVSLDDAAQAAFTFPIACNVDLHYFSSTYFSISEPSPWRIMYRVEDSNVIEGVKFASIKAKLRLSSAKHSTDIRFKPPTINILSKGYTKDCIDFWSVEKGETRRRLLNPTPTARSQQPITHRPITIHPGETWATRSQIGLPSSLGPAQLEHFRSQSMRMDPSTTPTDLDNDSTEYPYQKLHRLHTPDLDPGDSISQAQSDSVSRKDLETLLESTINKCLYKIKSDAPRQL

References More References in PubMed

1

Proteome Mapping of South African Cassava Mosaic Virus-Infected Susceptible and Tolerant Landraces of Cassava.

Ramulifho E, et al.  Proteomes. 2021 Oct 23;9(4):41. doi: 10.3390/proteomes9040041.

PMID: 34842800

2

RNA silencing of South African cassava mosaic virus in transgenic cassava expressing AC1/AC4 hp- RNA induces tolerance.

Walsh HA, et al.  Biotechnol Rep (Amst). 2019 Oct 30;24:e00383. doi: 10.1016/j.btre.2019.e00383. eCollection 2019 Dec.

PMID: 31763196

3

Differential miRNA profiles in South African cassava mosaic virus-infected cassava landraces reveal clues to susceptibility and tolerance to cassava mosaic disease.

Bizabani C, et al.  Virus Res. 2021 Oct 2;303:198400. doi: 10.1016/j.virusres.2021.198400. Epub 2021 Mar 19.

PMID: 33753179

4

Expression, Purification, and Characterisation of South African Cassava Mosaic Virus Cell-to-Cell Movement Protein.

Nankoo N, et al.  Curr Issues Mol Biol. 2022 Jun 15;44(6):2717-2729. doi: 10.3390/cimb44060186.

PMID: 35735627

5

A cassava protoplast system for screening genes associated with the response to South African cassava mosaic virus.

Chatukuta P, et al.  Virol J. 2020 Nov 23;17(1):184. doi: 10.1186/s12985-020-01453-4.

PMID: 33228712

6

Sequences enhancing cassava mosaic disease symptoms occur in the cassava genome and are associated with South African cassava mosaic virus infection.

Maredza AT, et al.  Mol Genet Genomics. 2016 Jun;291(3):1467-85. doi: 10.1007/s00438-015-1049-z. Epub 2015 Apr 29.

PMID: 25920485

7

Transcriptional analysis of South African cassava mosaic virus-infected susceptible and tolerant landraces of cassava highlights differences in resistance, basal defense and cell wall associated genes during infection.

Allie F, et al.  BMC Genomics. 2014 Nov 20;15:1006. doi: 10.1186/1471-2164-15-1006.

PMID: 25412561

8

Small RNA and methylation responses in susceptible and tolerant landraces of cassava infected with South African cassava mosaic virus.

Rogans SJ, et al.  Virus Res. 2016 Oct 2;225:10-22. doi: 10.1016/j.virusres.2016.08.011. Epub 2016 Aug 29.

PMID: 27586073

9

Nitric oxide associated protein 1 is associated with chloroplast perturbation and disease symptoms in Nicotiana benthamiana infected with South African cassava mosaic virus.

Mwaba I, et al.  Virus Res. 2017 Jun 15;238:75-83. doi: 10.1016/j.virusres.2017.05.022. Epub 2017 May 31.

PMID: 28577889

10

Complete nucleotide sequence and host range of South African cassava mosaic virus: further evidence for recombination amongst begomoviruses.

Berrie LC, et al.  J Gen Virol. 2001 Jan;82(Pt 1):53-58. doi: 10.1099/0022-1317-82-1-53.

PMID: 11125158