Sida yellow vein virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_000843025.1
Release date 2015/2/12
Submitter Frischmuth,T., Engel,M., Lauster,S., Jeske,H.
Vector
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_004661
TGGCATTTTTGTAATAAGAGTGTGTACTCCTGATGAGCTCCCTCAAAACTGGCCTATTCAATTGGAGTATTGGAGGCTAATATATAGTAGAACTCTCATTAACGGATTTGCAACACGTGGCGGCCATCCGCTATAATATTACCGGATGGCCGCGCGGAGTACGCTCCCCCCACGCGCGCACGCTCCTCTTTAATTTGAATTAAAGCTCTCCGCTTTCGTTTCGTCCAATCATGTAACGTCTGACGAGCTTAGATATTTTGAACAACTTGGGCGCTAAGTTGTTGAGTGTCGGTTATAAATTAAAGAGGGCCCAGCCCACTGTCTTTAACTCAAAATGCCTAAGCGCGATCTCCCATGGCGCTCGATCGCGGGAACTTCAAAGGTTAGTCGCAATGCTAATTATTCTCCACGTGCAGGAAGTGGGCCGGGGGTGAACAAGGCCTCCGAATGGGTTAACAGGCCCATGTACAGGAAGCCCAGGATATACCGGACGTTAAAGACGCCCGGCGTCCCACGAGGCTGTGAAGGCCCGTGCAAGGTCCAGTCCTATGAACAGCGTCATGATATATCACATGTGGGTAAGGTCATGTGTATATCTGATGTGACACGTGGAAATGGTATCACCCACCGTGTTGGTAAGCGTTTCTGTGTTAAGTCCGTGTACATTCTCGGTAAGATCTGGATGGATGAGAACATCAAGCTCAAGAACCACACGAACAGTGTCATGTTCTGGTTGGTCAGGGACCGTAGACCGTATGGCACGCCCATGGACTTTGGCCAGGTGTTCAACATGTTCGACAATGAGCCTAGCACTGCCACGGTGAAGAACGATCTACGCGATCGTTACCAAGTCATGCACAAATTCTATGGTAAGGTGACAGGTGGACAGTATGCGAGCAACGAGCAGGCTATAGTCAAGCGCTTCTGGAAGGTCTACAATCATGTGGTCTACAACCATCAGGAGGCTGGCAAGTACGAGAATCATACGGAGAACGCTTTGTTATTGTATATGGCATGTACTCATGCGTCTAACCCTGTGTATGCAACGCTTAAGATTCGTATCTATTTCTACGATTCGATCATGAATTAATAAATTTTGAATTTTATTGAATGATTTCCCAGTACACGAGTTACATAGAATCTGTCTGTTGCGAAACGAACAGCTCTAATTACATTGTTAATGCAAATAACTCCTAATCGATCTAAATACATGTTAACTAAACGTCTAAACCTAGCTAAATAGGTCGACCCAGAAGCTGTTATCGATATCGTCCAGACTTGGAAGTTCAGGAAGGCTTTGTGGAGATGCAATGCTCTCCTCAGGTTGTGGTTGAACCGTATCTGGATATTGTATACCCTGCTGTTGGTGTAGATTGGATCCTCTACTAGGAACATCTTGAAATAAAGGGGATTTTCGATCTCCCAGGTATAAACGCCATTCTCTGCCTGATGTGCAGTGATGAGTTCCCCTGTGCGTGAATCCATGCCCTGTGCAGCCTATGTGGAAGTAGATGGAGCAACCGCACTCCAGATCAATCCGCCGTCTCCTGATCGACCTCCTCTTGGCTTGCCTGTGCGCTGTCTTGATAGAGGGCGGATGTGAGGGTGATGAAGACCGCATTCTTGATGGTCCAGTTAAGTAGTGATGAGTTTTCCTCTTTGTTCAGGAAATCTTTATAGCTGGCACCCTCACCAGGATTGCAAAGCACGATTGATGGGATCCCTCCTTTAATTTGAACTGGCTTGCCGTACTTACAATTTGACTGCCAGTCCTTCTGGCCCCAGAAAGATTCTTTCCAGTGCTTTAGCTTTAGATATTGCGGTGCGACGTCATCAATGACGTTATACTCCACTTCGTTCGAATAGACTCTTGGGTTGAAGTCCAGATGTCCACTAAGATAATTATGTGGGCCTAACGCACGAGCCCACATCGTCTTCCCTGTTCTCGAATCACCTTCCACGATGATACTAACAGGTCTCTCTGGGCGCGCAGCGGAATCACACCCAAAATAATCATCCGCCCACTCTTGCATCCTCTCCGGCACGTTAGTGAATGAGGAGAGTTGAAACGGAGGAACCCACGGTGACGGAGCCTTTGCGAATATTCTCTCTAGGTTTGAGCGGATGTTATGATTTTGCAGGACAAAATCTTTGGGTTGTTCTTCCTTCAAAACCGTCATGGCACCTAGAACAGATCCTGCATTCAACGCCTTGGCATATGAATCGTTAGCTGTTTGCTGACCTCCCCTAGCAGATCTACCGTCGACCTGGAATTCTCCCCATTCAATGGTGTCCCCGTCCTTGTCGATGTAGGACTTGACATCGGAGCTGGATTTAGCTCCCTGAATGTTCGGATGGAAATGTACTGACCTGGTTGGGGACACCAGATCGAAGAGTCTGTTATTCGTGCATTGGTACTTCCCTTCGAACTGGATGAGCACATGCAGATGAGGTTCCCCATTCTCATGCAATTCTCTGCAGATCTTGATGAACTTCTTGTTAACTGGAGTTTGTAGGTTTTCTAATTGGGAAAGTGCTTCCTCTTTAGTAAGAGAGCACTGGGGATATGTGAGGAAATAATTTTTGGACTGGACTCTAAATCTCTTAGGCGG

NC_004662
TGGCATTTTTGTAATAAGAGGGTGTACTCCTGATGAGCTCCCTCAAAACTGGCCTATTCAATTGGAGTATTGGAGGCTAATATATAGTAGAACTCTCATTAACGGATTTGCAACACGTGGCGGCCATCCGCTATAATATTACCGGATGGCCGCGCGCCGCCCGCTCCCTGCCACCTGGCGCTCTCTCCTCCCTTGGTGCTGGTGACCCTGACACTTGGCGCGCTCTCGACCCTCGATCTTTATATACCCACGTGGTTCGGCTAGTCTTTGTTGACCGACGCTTTAATTCAAATTAAAGCTCAACTCTTTTATGTCGCGCGATATCAATTCGAATTTGAATTATTGATTCGCGTTTTCTGAGTGTGCCCCATTGTACTACATGGACGACGTGGCCGATTTGAGACCATGCTGCTGAGCTAAGTTAAGTGTATGTCTGACTCATCCTTGTCTTTAAATTGGTCCGGAATGATATATTATATTTTAAGTGACTCAGCTGTTAACCACGTTTAAATCGTTAGCCTTATTATTCGTCTAATTACGTCTTATCCTTTGATCATGTATCCATGTAGGTATAAACGTGGTCCCTCCTTCACTCCACGACGATTTTATTCACGTAACCATGTGTTTAAGCGTTCTAATCCACTCAAACGCGATGATGGGAAACGAAGGCCTGTTAACTCTAATAAGGCCCATGATGAGTCAAGGATGAAAGCCCAACGGATCCACGAGAACCAGTTTGGACCTGACTTTGTTATGGCCCATAATTCGGCCATTTCCACGTTTATCAGCTATCCAAACCAGGGTAAGACTGAACCGAACCGGAGCAGGTCCTACATCAAGTTGAGACGACTGCGTTTCAAAGGAACTGTGAAGATTGAACGTGTCCAGTCTGATATGAACATGGACTGTGCTACCCCCAAGGTTGAAGGAGTGTTCTCCCTTGTCGTAGTTGTGGATCGTAAACCCCACTTGGGTGCATCTGGTTGTCTTCACACTTTCGACGAGCTGTTCGGTGCCAGGATCCACAGTCACGGTAATCTCAGCATCACTCCTTCCCTGAAGGACCGTTTCTACATAAGACACGTGTTCAAACGTGTGTTGTCTGTGGAGAAGGATACGTTGATGGTTGACGTGGAAGGGTCCACCACTCTCTCTAACAGGCGATATAACTGTTGGTCCACGTTTAAGGATCTTGATCACGATTCATGTAACGGTGTTTATGGCAACATTAGCAAGAACGCCCTCTTAGTTTATTATTGTTGGATGTCAGATACTGTGTCTAAGGCATCTACATTTGTATCGTTTGACCTTGACTATGTTGGATGATTAATAAAACAATAATATTTATTGCAATGATTTGGGCTGTGCCGGTTTACAATTATTGATAATACATTCTTGGACCGTAGTCCTCACTAGCTCGTTTAATTGGCCCATCGACATTGTGATGTTGGATTCTGCTCTCTGGGCTCCCACGATCGAAGCAGACTCTCCTGGATCTAACACGTTGGTCCCAAGCCTGCTTAGGTGCCTGTACGGGTGAAGCTCGTTCTCCACCTCGGAGTCCGCATCTGAATGCCCAGTTCCCACCGCACTCCTGGAAGCCCATGATTCTCCTGGCCTGATTTCAATTGGGCCTCTGAGCCCAGTTCTTGACATGGACGCGCATCTGATGGGCTTCCTTTCCCATCTTCCGTAGTCGACGTGCGAGAAGTCCACATCCTTGTCGGTGAACTGCTTGGAAAGGATCTTCACCGTCGGTGCCCGGAAAGGGATATCAACCGAGTGTTTCGCCGTCGACAGTTTCAGTTTCCCTTTGAATTTCGCGAAGTGGGTTCTCTGATGAACATTCGTATCGCAGACCCTGTAGTACAGCTTCCATGGAATTGGGTCCTTCAGCGAGAAGAACGAAGCGGAAAAGTAATGGAGATCAATGTTGCATCTGATCGGAAACGTCCACGATGCCTGTAGAGACTCATTGTCCGTCATTCTCTTGTCGTGGATCTCCACTATCACCGACCCCGTCGCGTTGATCGGAACTTGCTGCCTGTATTCTATGACACAGTGGTCGATCTTCATGCAGCTCCTGCTCAATCTCGCCGTCAACTGCGACGCCGTCGACGGAAATTGCAGAATTATCTCAGTTAGGTCATGGGAAAGCTGATACTCGTCTCGATGTGACTCTATGTAGTTGAAGGCGTTGGGAGGATTAACTAACTGAGAATCCATATGAGAAAGAAAGGCCGCGCAGCTGAAACCGATTGCTGAAGTTGAACAATTTGAGAAGATGCTACGGTTCCGTACGACTAACTGATGAAGAACTTCTGTTGAAGAATAAAATGTTTCCTGTGGTTTTCAGAAAGTAGCTGTTGAAGATGAACAACACTGGTTTAGGTTTCTGGGTTTCCCAGAAAGTAACTGATGAACAGGAAGAACAGTCGTTTAATTTCTAATGAATATGTTGTTTTGTTTTTGAGAAAGAGGAGAAATCTGGAGAGTAAAGTAAGTTATGTGTTTAGTTAGATCTGATATGTTTATATAGACACCCTATCGTTATGTTTTTAGAGCGTTCAGAGGAAGTCTTTTGTTTAATGAA

Gene Information

NCBI Accession NP_808900.1
Location 1533-2612,1-6
Gene Name AC1
Protein Name AC1 protein
Coding Region ATGCCACCGCCTAAGAGATTTAGAGTCCAGTCCAAAAATTATTTCCTCACATATCCCCAGTGCTCTCTTACTAAAGAGGAAGCACTTTCCCAATTAGAAAACCTACAAACTCCAGTTAACAAGAAGTTCATCAAGATCTGCAGAGAATTGCATGAGAATGGGGAACCTCATCTGCATGTGCTCATCCAGTTCGAAGGGAAGTACCAATGCACGAATAACAGACTCTTCGATCTGGTGTCCCCAACCAGGTCAGTACATTTCCATCCGAACATTCAGGGAGCTAAATCCAGCTCCGATGTCAAGTCCTACATCGACAAGGACGGGGACACCATTGAATGGGGAGAATTCCAGGTCGACGGTAGATCTGCTAGGGGAGGTCAGCAAACAGCTAACGATTCATATGCCAAGGCGTTGAATGCAGGATCTGTTCTAGGTGCCATGACGGTTTTGAAGGAAGAACAACCCAAAGATTTTGTCCTGCAAAATCATAACATCCGCTCAAACCTAGAGAGAATATTCGCAAAGGCTCCGTCACCGTGGGTTCCTCCGTTTCAACTCTCCTCATTCACTAACGTGCCGGAGAGGATGCAAGAGTGGGCGGATGATTATTTTGGGTGTGATTCCGCTGCGCGCCCAGAGAGACCTGTTAGTATCATCGTGGAAGGTGATTCGAGAACAGGGAAGACGATGTGGGCTCGTGCGTTAGGCCCACATAATTATCTTAGTGGACATCTGGACTTCAACCCAAGAGTCTATTCGAACGAAGTGGAGTATAACGTCATTGATGACGTCGCACCGCAATATCTAAAGCTAAAGCACTGGAAAGAATCTTTCTGGGGCCAGAAGGACTGGCAGTCAAATTGTAAGTACGGCAAGCCAGTTCAAATTAAAGGAGGGATCCCATCAATCGTGCTTTGCAATCCTGGTGAGGGTGCCAGCTATAAAGATTTCCTGAACAAAGAGGAAAACTCATCACTACTTAACTGGACCATCAAGAATGCGGTCTTCATCACCCTCACATCCGCCCTCTATCAAGACAGCGCACAGGCAAGCCAAGAGGAGGTCGATCAGGAGACGGCGGATTGA
Protein Sequence MPPPKRFRVQSKNYFLTYPQCSLTKEEALSQLENLQTPVNKKFIKICRELHENGEPHLHVLIQFEGKYQCTNNRLFDLVSPTRSVHFHPNIQGAKSSSDVKSYIDKDGDTIEWGEFQVDGRSARGGQQTANDSYAKALNAGSVLGAMTVLKEEQPKDFVLQNHNIRSNLERIFAKAPSPWVPPFQLSSFTNVPERMQEWADDYFGCDSAARPERPVSIIVEGDSRTGKTMWARALGPHNYLSGHLDFNPRVYSNEVEYNVIDDVAPQYLKLKHWKESFWGQKDWQSNCKYGKPVQIKGGIPSIVLCNPGEGASYKDFLNKEENSSLLNWTIKNAVFITLTSALYQDSAQASQEEVDQETAD

NCBI Accession NP_808901.1
Location 335-1090
Gene Name AV1
Protein Name coat protein
Coding Region ATGCCTAAGCGCGATCTCCCATGGCGCTCGATCGCGGGAACTTCAAAGGTTAGTCGCAATGCTAATTATTCTCCACGTGCAGGAAGTGGGCCGGGGGTGAACAAGGCCTCCGAATGGGTTAACAGGCCCATGTACAGGAAGCCCAGGATATACCGGACGTTAAAGACGCCCGGCGTCCCACGAGGCTGTGAAGGCCCGTGCAAGGTCCAGTCCTATGAACAGCGTCATGATATATCACATGTGGGTAAGGTCATGTGTATATCTGATGTGACACGTGGAAATGGTATCACCCACCGTGTTGGTAAGCGTTTCTGTGTTAAGTCCGTGTACATTCTCGGTAAGATCTGGATGGATGAGAACATCAAGCTCAAGAACCACACGAACAGTGTCATGTTCTGGTTGGTCAGGGACCGTAGACCGTATGGCACGCCCATGGACTTTGGCCAGGTGTTCAACATGTTCGACAATGAGCCTAGCACTGCCACGGTGAAGAACGATCTACGCGATCGTTACCAAGTCATGCACAAATTCTATGGTAAGGTGACAGGTGGACAGTATGCGAGCAACGAGCAGGCTATAGTCAAGCGCTTCTGGAAGGTCTACAATCATGTGGTCTACAACCATCAGGAGGCTGGCAAGTACGAGAATCATACGGAGAACGCTTTGTTATTGTATATGGCATGTACTCATGCGTCTAACCCTGTGTATGCAACGCTTAAGATTCGTATCTATTTCTACGATTCGATCATGAATTAA
Protein Sequence MPKRDLPWRSIAGTSKVSRNANYSPRAGSGPGVNKASEWVNRPMYRKPRIYRTLKTPGVPRGCEGPCKVQSYEQRHDISHVGKVMCISDVTRGNGITHRVGKRFCVKSVYILGKIWMDENIKLKNHTNSVMFWLVRDRRPYGTPMDFGQVFNMFDNEPSTATVKNDLRDRYQVMHKFYGKVTGGQYASNEQAIVKRFWKVYNHVVYNHQEAGKYENHTENALLLYMACTHASNPVYATLKIRIYFYDSIMN

NCBI Accession NP_808902.1
Location 1087-1485
Gene Name AC3
Protein Name AC3 protein
Coding Region ATGGATTCACGCACAGGGGAACTCATCACTGCACATCAGGCAGAGAATGGCGTTTATACCTGGGAGATCGAAAATCCCCTTTATTTCAAGATGTTCCTAGTAGAGGATCCAATCTACACCAACAGCAGGGTATACAATATCCAGATACGGTTCAACCACAACCTGAGGAGAGCATTGCATCTCCACAAAGCCTTCCTGAACTTCCAAGTCTGGACGATATCGATAACAGCTTCTGGGTCGACCTATTTAGCTAGGTTTAGACGTTTAGTTAACATGTATTTAGATCGATTAGGAGTTATTTGCATTAACAATGTAATTAGAGCTGTTCGTTTCGCAACAGACAGATTCTATGTAACTCGTGTACTGGGAAATCATTCAATAAAATTCAAAATTTATTAA
Protein Sequence MDSRTGELITAHQAENGVYTWEIENPLYFKMFLVEDPIYTNSRVYNIQIRFNHNLRRALHLHKAFLNFQVWTISITASGSTYLARFRRLVNMYLDRLGVICINNVIRAVRFATDRFYVTRVLGNHSIKFKIY

NCBI Accession NP_808903.1
Location 1232-1621
Gene Name AC2
Protein Name AC2 protein
Coding Region ATGCGGTCTTCATCACCCTCACATCCGCCCTCTATCAAGACAGCGCACAGGCAAGCCAAGAGGAGGTCGATCAGGAGACGGCGGATTGATCTGGAGTGCGGTTGCTCCATCTACTTCCACATAGGCTGCACAGGGCATGGATTCACGCACAGGGGAACTCATCACTGCACATCAGGCAGAGAATGGCGTTTATACCTGGGAGATCGAAAATCCCCTTTATTTCAAGATGTTCCTAGTAGAGGATCCAATCTACACCAACAGCAGGGTATACAATATCCAGATACGGTTCAACCACAACCTGAGGAGAGCATTGCATCTCCACAAAGCCTTCCTGAACTTCCAAGTCTGGACGATATCGATAACAGCTTCTGGGTCGACCTATTTAGCTAG
Protein Sequence MRSSSPSHPPSIKTAHRQAKRRSIRRRRIDLECGCSIYFHIGCTGHGFTHRGTHHCTSGREWRLYLGDRKSPLFQDVPSRGSNLHQQQGIQYPDTVQPQPEESIASPQSLPELPSLDDIDNSFWVDLFS

NCBI Accession NP_808904.1
Location 2204-2467
Gene Name AC4
Protein Name AC4 protein
Coding Region ATGAGAATGGGGAACCTCATCTGCATGTGCTCATCCAGTTCGAAGGGAAGTACCAATGCACGAATAACAGACTCTTCGATCTGGTGTCCCCAACCAGGTCAGTACATTTCCATCCGAACATTCAGGGAGCTAAATCCAGCTCCGATGTCAAGTCCTACATCGACAAGGACGGGGACACCATTGAATGGGGAGAATTCCAGGTCGACGGTAGATCTGCTAGGGGAGGTCAGCAAACAGCTAACGATTCATATGCCAAGGCGTTGA
Protein Sequence MRMGNLICMCSSSSKGSTNARITDSSIWCPQPGQYISIRTFRELNPAPMSSPTSTRTGTPLNGENSRSTVDLLGEVSKQLTIHMPRR

NCBI Accession NP_808905.1
Location 556-1326
Gene Name BV1
Protein Name BV1 protein
Coding Region ATGTATCCATGTAGGTATAAACGTGGTCCCTCCTTCACTCCACGACGATTTTATTCACGTAACCATGTGTTTAAGCGTTCTAATCCACTCAAACGCGATGATGGGAAACGAAGGCCTGTTAACTCTAATAAGGCCCATGATGAGTCAAGGATGAAAGCCCAACGGATCCACGAGAACCAGTTTGGACCTGACTTTGTTATGGCCCATAATTCGGCCATTTCCACGTTTATCAGCTATCCAAACCAGGGTAAGACTGAACCGAACCGGAGCAGGTCCTACATCAAGTTGAGACGACTGCGTTTCAAAGGAACTGTGAAGATTGAACGTGTCCAGTCTGATATGAACATGGACTGTGCTACCCCCAAGGTTGAAGGAGTGTTCTCCCTTGTCGTAGTTGTGGATCGTAAACCCCACTTGGGTGCATCTGGTTGTCTTCACACTTTCGACGAGCTGTTCGGTGCCAGGATCCACAGTCACGGTAATCTCAGCATCACTCCTTCCCTGAAGGACCGTTTCTACATAAGACACGTGTTCAAACGTGTGTTGTCTGTGGAGAAGGATACGTTGATGGTTGACGTGGAAGGGTCCACCACTCTCTCTAACAGGCGATATAACTGTTGGTCCACGTTTAAGGATCTTGATCACGATTCATGTAACGGTGTTTATGGCAACATTAGCAAGAACGCCCTCTTAGTTTATTATTGTTGGATGTCAGATACTGTGTCTAAGGCATCTACATTTGTATCGTTTGACCTTGACTATGTTGGATGA
Protein Sequence MYPCRYKRGPSFTPRRFYSRNHVFKRSNPLKRDDGKRRPVNSNKAHDESRMKAQRIHENQFGPDFVMAHNSAISTFISYPNQGKTEPNRSRSYIKLRRLRFKGTVKIERVQSDMNMDCATPKVEGVFSLVVVVDRKPHLGASGCLHTFDELFGARIHSHGNLSITPSLKDRFYIRHVFKRVLSVEKDTLMVDVEGSTTLSNRRYNCWSTFKDLDHDSCNGVYGNISKNALLVYYCWMSDTVSKASTFVSFDLDYVG

NCBI Accession NP_808906.1
Location 1345-2226
Gene Name BC1
Protein Name BC1 protein
Coding Region ATGGATTCTCAGTTAGTTAATCCTCCCAACGCCTTCAACTACATAGAGTCACATCGAGACGAGTATCAGCTTTCCCATGACCTAACTGAGATAATTCTGCAATTTCCGTCGACGGCGTCGCAGTTGACGGCGAGATTGAGCAGGAGCTGCATGAAGATCGACCACTGTGTCATAGAATACAGGCAGCAAGTTCCGATCAACGCGACGGGGTCGGTGATAGTGGAGATCCACGACAAGAGAATGACGGACAATGAGTCTCTACAGGCATCGTGGACGTTTCCGATCAGATGCAACATTGATCTCCATTACTTTTCCGCTTCGTTCTTCTCGCTGAAGGACCCAATTCCATGGAAGCTGTACTACAGGGTCTGCGATACGAATGTTCATCAGAGAACCCACTTCGCGAAATTCAAAGGGAAACTGAAACTGTCGACGGCGAAACACTCGGTTGATATCCCTTTCCGGGCACCGACGGTGAAGATCCTTTCCAAGCAGTTCACCGACAAGGATGTGGACTTCTCGCACGTCGACTACGGAAGATGGGAAAGGAAGCCCATCAGATGCGCGTCCATGTCAAGAACTGGGCTCAGAGGCCCAATTGAAATCAGGCCAGGAGAATCATGGGCTTCCAGGAGTGCGGTGGGAACTGGGCATTCAGATGCGGACTCCGAGGTGGAGAACGAGCTTCACCCGTACAGGCACCTAAGCAGGCTTGGGACCAACGTGTTAGATCCAGGAGAGTCTGCTTCGATCGTGGGAGCCCAGAGAGCAGAATCCAACATCACAATGTCGATGGGCCAATTAAACGAGCTAGTGAGGACTACGGTCCAAGAATGTATTATCAATAATTGTAAACCGGCACAGCCCAAATCATTGCAATAA
Protein Sequence MDSQLVNPPNAFNYIESHRDEYQLSHDLTEIILQFPSTASQLTARLSRSCMKIDHCVIEYRQQVPINATGSVIVEIHDKRMTDNESLQASWTFPIRCNIDLHYFSASFFSLKDPIPWKLYYRVCDTNVHQRTHFAKFKGKLKLSTAKHSVDIPFRAPTVKILSKQFTDKDVDFSHVDYGRWERKPIRCASMSRTGLRGPIEIRPGESWASRSAVGTGHSDADSEVENELHPYRHLSRLGTNVLDPGESASIVGAQRAESNITMSMGQLNELVRTTVQECIINNCKPAQPKSLQ

References More References in PubMed

1

First report of the complete sequence of Sida golden yellow vein virus from Jamaica.

Stewart CS, et al.  Arch Virol. 2011 Aug;156(8):1481-4. doi: 10.1007/s00705-011-1030-z. Epub 2011 May 29.

PMID: 21625977

2

A New Begomovirus Inducing Yellow Mottle in Okra Crops in Mexico is Related to Sida yellow vein virus.

De La Torre-Almaraz R, et al.  Plant Dis. 2006 Mar;90(3):378. doi: 10.1094/PD-90-0378B.

PMID: 30786574

3

An interspecies recombinant sida yellow mosaic China virus isolate and betasatellite cause a leaf curl disease in tobacco in Hainan, China.

Wang D, et al.  Plant Dis. 2023 Sep 24. doi: 10.1094/PDIS-07-23-1346-RE. Online ahead of print.

PMID: 37743589

4

Association of an alphasatellite with tomato yellow leaf curl virus and ageratum yellow vein virus in Japan is suggestive of a recent introduction.

Shahid MS, et al.  Viruses. 2014 Jan 14;6(1):189-200. doi: 10.3390/v6010189.

PMID: 24424499

5

First report of Ludwigia yellow vein Vietnam virus causing leaf curling on tobacco plants in Hainan province, China.

Wang D, et al.  Plant Dis. 2023 Apr 28. doi: 10.1094/PDIS-01-23-0034-PDN. Online ahead of print.

PMID: 37115566

6

Reconstruction and Characterization of Full-Length Begomovirus and Alphasatellite Genomes Infecting Pepper through Metagenomics.

Bornancini VA, et al.  Viruses. 2020 Feb 11;12(2):202. doi: 10.3390/v12020202.

PMID: 32054104

7

Begomoviruses infecting weeds in Cuba: increased host range and a novel virus infecting Sida rhombifolia.

Fiallo-Olivé E, et al.  Arch Virol. 2012 Jan;157(1):141-6. doi: 10.1007/s00705-011-1123-8. Epub 2011 Oct 1.

PMID: 21964921

8

Complete sequence of a new bipartite begomovirus infecting Sida sp. in Northeastern Brazil.

Macedo MA, et al.  Arch Virol. 2020 Jan;165(1):253-256. doi: 10.1007/s00705-019-04458-9. Epub 2019 Nov 22.

PMID: 31758274

9

Molecular characterization and phylogenetic relationships of two new bipartite begomovirus infecting malvaceous plants in Yucatan, Mexico.

Hernández-Zepeda C, et al.  Virus Genes. 2007 Oct;35(2):369-77. doi: 10.1007/s11262-007-0080-5. Epub 2007 Feb 15.

PMID: 17638064

10

Mixed infection of Sida jamaicensis in Jamaica reveals the presence of three recombinant begomovirus DNA A components.

Stewart C, et al.  Arch Virol. 2014 Sep;159(9):2509-12. doi: 10.1007/s00705-014-2063-x. Epub 2014 Apr 1.

PMID: 24687859