Pepper golden mosaic virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_000842765.1
Release date 2015/2/12
Submitter Torres-Pacheco,I., Garzon-Tiznado,J.A., Brown,J.K., Becerra-Flora,A., Rivera-Bustamante,R.F., Mendez-Lozano,J., Fauquet,C.M.
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_004096
ACTGGATGGCCGCGATTTTTTGGAGTCCTGCCAGCCTGTCCCCCACTATCTTTGTGACTCCAGGCACATTTCCCAAAGCATGGGCCCACAATGTCCCATCACCCGGGACCACTACAACTGAAGGCTGTTCTTTTTTTGGAGATCAATCAGGACCGTTGGCTAAACCTTATCGCGCCCGTTCTTTTGAAATTTGAATTATTGGCGCGATTACCAATAAATGGACCATGTGTATAACTGGGTCGATGTTGACAGATTTGTATTTGAGCAGTACATGGTCCAGTAAAAACTCAAGTGTAGAGTTATGTAATTTGAAATGATAATCGTGTTGACTATATAATGGACTTGAGTTTTGATACATGAAATCGTCAGTTAAGGATTAAAGATATACATCGTTCTAATATGTATCAGTCAAGGTATACACGTGTGGCACCCTATGTGCAGAGACGATTTCAACGACGTAATCAAGTGTTTAAGCGCACAGTATCAGGGAGACGTAATGACGTTAAACGTCGATCAAGTCAATTAATTAAGAGTAATGAGGAACCTAAGATTACGTCGCAGCGCATACATGAAAACCAATATGGCCCTGAGTTCGTTATGGCGCATAATGCAGCTATTTCCACGTTCATTAATTATCCTGTACTTGGTAAGACTCAACCTAATCGAAGCAGGTCGTATATTAAGCTTAAACGTTTATCGTTTAAGGGAACCGTTAAGATTGAACGTGTGCATGCTGACGTGAACATGGACGGGGTCTGTCCTAAAATTGAAGGCGTCTTCTCACTGGTTATTGTGGTTGATCGTAAACCACATTTAAGTTCGTCTGGGGTGTTGCATACATTTGATGAAGTATTCGGTGCAAGAATCCACAGCCATGGGAACTTAGCCATTACAACATCTTTGAAAGATCGGTATTACGTCCGGCATGTATTGAAGCGCGTATTGTCAGTTGAGAAGGACACTGTCATGGTAGATATCGAAGGATGCACATCCCTTTCTAACAAGCGCTTCAACTGCTGGTCTACATTTAAGGATTTAGAACATGACACATGTAACGGTGTTTATGCGAATATAAGCAAGAATGCCATATTAGTTTACTATTGCTGGATGTCGGATGTCATGTCTAAAGCATCCACATTTGTATCATATGACCTAGAATATGTAGGGTGAATCCATAATAAAATATGTAAATATATTGGACAAGTAATTGACTGATACAAATGTATTTATTGCAAAGACTTCGGCTGTGCCGGGTTACAATTGTTACTAATACATTCGTGAACCGTAGTCCTAACAAGTTCGTTCAATTGGGCCATTGACATTGTTATATTGGAGTGGGCTCTTTGTAGACCAACCTGTGATGCGGAATCACCTGGGTCTAATACGCTTGGGCCCAATTGATGAAGCTCTCTATAGGGGTGCATCTTCGAATCCCTTGAAGGACTACTTGTACCCACGGTGCTCCTGGAAGCCCATGACTCACCTGGCCTCAATTCAATTGGGCCTGTAAGCCCAACCCTTGACATTGAATTGGACCGTAAGACTTTGCGCTCCCACTGGCCATAGTCCACATGGGAGAAGTCCACATCGTTATGGGAGAATTGTTTAGATAGTATTTTGACAGTGGGAGCCCGGAATGGTATATCTACCGAGTGCTTAGCTGTTGAGAGTTTTAGCTTGCCTTTGAACTTGGCAAAATGAGTCCTTTGATGTACATTTGTGTCGGACACTCGGTAGTATAATCTCCATGGAATGGGGTCCTTCAGTGAAAAGAATGACGACGAGAAGTAATGTAGGTCTATGTTGCATCGTATTGGAAATGTCCAAGATGCTTGTAATGACTCGTTATCCGTCATTCTTTGGTCATGAATCTCCACAATGACCGACCCAGAGGCGTTAATCGGAACCTGCTGTCTATATTCTATGACGCAGTGGTCAATTTTCATACAGCTGCGACTTAGTCGTGCCGTTAGCTGTGATGCCGTGGAAGGAAACTGAAGGACTATCTCMGTCAGATCATGCGACAGCTGGTATTCATCTCTATGAGATTCAAGATAATTAAAGGCGCTAGGAGCACTCGCCAACCCCGCTTCCATATCTGAAAATATGCCGCAGCAGAAGTGTTTCGCGCANAAGAGGATGTTGCTATCACGGNTTTATATACAGGTGCGGCATTAACAAGGCAAAACACTTGTACCGGTTGTTGCTGAAGTTCTGTCAAAGAATTAAAGAATTGGTAAAGGAAGTCTGTGGGAGCAGCTTAGTAATATGGGAAGCTATGGCAACAACCAACAAAGCTCAAACTGATATGAAGAGGATCAGAATTTTGGATATGGCGATACAAGTTGTTTATTAGAGAAACTGCAATGAGATGTCCTCTGAGTAAGGGATTATATAGAGATAACATCCGAACGTACGCTTAAGAATTGTTTGAACTAGTTGAGAAGAATGGCAAATATGTAAATATGGTATAGGACTCCAGCGGAGTCCCTCAACTCCTGTCATATATTGTGGAGTCCTGGAGTCCCTTATATACATAAAGCCTCTAGGACTCTAAAGGACAGGTGCCCTAATCGCGGCCATCCATATAATATT

NC_004101
ACCGGATGGCCGCGATTTTTTGGAGTCTTTAGGGGACCACTCACAATAGAGGGCTGAGATTAAATAGACAGAGTGAGGGGACCACCAATTATTTGATTTTGACTGACCAATCACATCCCGCCTGTCAAGTCTAGATATTTGTGCCTTGGTGACCAAGGTGTGGGCCTATAAATGCACGTGCATCTGCATTTATCGCTTTAATTCAAAATGGTTAAGCGGGATGCCCCATGGCGTTTAATGGCGGGGACCTCTAAGGTTTCCGGCTCTGCGAATTATTCACGTGGCACGGGTATGGGGCCTAAATTCGATAAGGCCGCTGCTTGGGTTAACAGGCCCATGTACAGGAAGCCCAGTATATATCGTACGTATAGAAGCCCAGATGTGCCTAGASSATGTGAAGGGCCATGTAAGGTCCAGTCCTTCGAGCAGCGGCATGATATCTCGCATGTTGGCAAGGTCATGTGCATTTCTGACGTGACACGTGGTAATGGTATTACCCATCGTGTAGGCAAGCGTTTCTGCGTCAAGTCTGCATACGTTCTGGGTAAGATATGGATGGACGAGAATATCAAGCTCAAGAACCACACCAACAGCGTCATGTTCTGGCTCGTGAGAGATAGGAGACCATATGGTACCCCTATGGACTTTGGTCAGGTGTTCAACATGTATGACAACGAGCCCAGTACAGCTACTGTGAAGAACGATTTGCGTGATCGTTTCCAAGTCATGCACAGGTTCTCGGCTAAGGTCACAGGTGGACAGTATGCCAGCAACGAGCAGGCATTGGTTAGGCGTTTCTGGAAGGTGAACAACTACGTCGTGTACAACCATCAGGAAGCTGGCAAATACGAGAATCATACTGAGAACGCCCTGCTATTGTATATGGCATGTACACATGCCTCTAACCCTGTGTACGCGACATTGAAAATTCGAATCTATTTTTATGATTCGATAACAAATTAATAAAGTTTGCATTTTATTTCATGATTCTCAAGTACATAATTTACATAGGATTTGTCCGTCGCAAAACGAACAGCTCTGATTACATTGTTTATGCCTATGGCCCCTAGCGTATGTAAATACAACATGACGCGAAATTTGAATCTACTTAAATATGTCGTCCCAGAAGCTGTCATCGAAGTCGTCCAGACTTGGAAATGGAGGAATGCCTTGTGGAGAGCTAATGCTCGACGTAGGTTGTGGTTGAACCGGACTACGATGTGGTATATCCTGGTTCTGGTGAACAACGGGTCCTCCACGTGCTGTATCCTGAAAAATAGGGGATTTGGAACCTCCCAAATAAAAACGGAATTCTCTGCCTGATGCACAGTGATGCTCTCCCCTGTGCGTGAATCCATTATTAGCGCAGTTGATGTGGAGAAAGATAGAGCAGCCGCAGTTTAGGTCTATGCGTCGTCTGCGAATAGGTCGCTTCTTAGCTATCCTGTGCTGTGCTTTTATAGAGGGGAGCGTGGAGGATGACGAATTGAGCATTTTTTAATGTCCACGCTCTTAATTCTGCATTTTCCTCTTTGTTGAGGAAAGCTATATAGCTGCTACCTTCCCCTGGATTGCACAGCACGATTGATGGTATCCCGCCTTTAATTTGAACTGGCTTTCCGTATTTACAGTTGGACTGCCAGTCTTTTTGGGCCCCAATAAGCTCTTTCCAGTGTTTCATCTTTAGATATTGGGGCGTGATATCATCAATGACGTTATACTCCACATAGTTTGAATAGACCTTTGCATTGAAATCAAGATGACCGCTCAAATAATTATGTGGGCCTAGTGCACGTGCCCACATTGTCTTGCCGCATCGCGAATCACCCTCAATGACAATACTAATCGGTCTATCTGGCCGCGCACAACTCCGACCAAAATATTCAGCAACCCAATGTTGCATATCCTCAGGAACGTTGTTAAACGAGGATAATGGATAAGGAGGAGTCCATGGCATAGGAGGAGTTGTAAATAGGCGCTCGATGTTAGCCTTTATGTTATGATAACTAACAATGAACGTTTTCGGATCACCAGCTTTGATTATGTCGAGCGCCTCCCCCGCACTTGCAGCATTTACAGCGTTATGGTAGACGTCGTCTTTATTTGCTTTTGACCCCCCGGAAACTTTGTACTGCCCAGATTCACAATAATCACCATCTTTTGTTATGTAATTTTTAACGGCATTTGCGTCCTTGGATGCCTGAACGTTTGGATGAAACTGGGCAGATCTCCGGGGGTGAGTAATGTCGAAGAACCGGGCATCTTTGATGTTGCATTTTCCAGTCAACTGGATTAGACAGTGCAAGTGCGGGAACCCATCGGAATGCTCCTCTCGTGATACCCGGAGATAGATGGGTTTTACCACTGCCCATTTTAAATTACGGAGCATTTCGAGAGCTTCATCCTTTGGGATATCGCATTGTGGATATGTTAAGAAAATGTTTTTACATTGTAAACGAAAGGATTTTGGTGGTAGTGGCATTTTTGCAAATATGGTGTAGGACTCCAGCAGAGTCCCTCAACTTCTGTCATATGTTGTGGAGTCCTGGAGTCCCTTATATACATAAAGCCTCTTGGGGACTCCAAGGGCAAAAGCGGCCATCCTATAATATT

Gene Information

NCBI Accession NP_671456.1
Location 400-1170
Gene Name BR1
Protein Name nuclear shuttle
Coding Region ATGTATCAGTCAAGGTATACACGTGTGGCACCCTATGTGCAGAGACGATTTCAACGACGTAATCAAGTGTTTAAGCGCACAGTATCAGGGAGACGTAATGACGTTAAACGTCGATCAAGTCAATTAATTAAGAGTAATGAGGAACCTAAGATTACGTCGCAGCGCATACATGAAAACCAATATGGCCCTGAGTTCGTTATGGCGCATAATGCAGCTATTTCCACGTTCATTAATTATCCTGTACTTGGTAAGACTCAACCTAATCGAAGCAGGTCGTATATTAAGCTTAAACGTTTATCGTTTAAGGGAACCGTTAAGATTGAACGTGTGCATGCTGACGTGAACATGGACGGGGTCTGTCCTAAAATTGAAGGCGTCTTCTCACTGGTTATTGTGGTTGATCGTAAACCACATTTAAGTTCGTCTGGGGTGTTGCATACATTTGATGAAGTATTCGGTGCAAGAATCCACAGCCATGGGAACTTAGCCATTACAACATCTTTGAAAGATCGGTATTACGTCCGGCATGTATTGAAGCGCGTATTGTCAGTTGAGAAGGACACTGTCATGGTAGATATCGAAGGATGCACATCCCTTTCTAACAAGCGCTTCAACTGCTGGTCTACATTTAAGGATTTAGAACATGACACATGTAACGGTGTTTATGCGAATATAAGCAAGAATGCCATATTAGTTTACTATTGCTGGATGTCGGATGTCATGTCTAAAGCATCCACATTTGTATCATATGACCTAGAATATGTAGGGTGA
Protein Sequence MYQSRYTRVAPYVQRRFQRRNQVFKRTVSGRRNDVKRRSSQLIKSNEEPKITSQRIHENQYGPEFVMAHNAAISTFINYPVLGKTQPNRSRSYIKLKRLSFKGTVKIERVHADVNMDGVCPKIEGVFSLVIVVDRKPHLSSSGVLHTFDEVFGARIHSHGNLAITTSLKDRYYVRHVLKRVLSVEKDTVMVDIEGCTSLSNKRFNCWSTFKDLEHDTCNGVYANISKNAILVYYCWMSDVMSKASTFVSYDLEYVG

NCBI Accession NP_671457.1
Location 1227-2096
Gene Name BL1
Protein Name viral movement protein
Coding Region ATGGAAGCGGGGTTGGCGAGTGCTCCTAGCGCCTTTAATTATCTTGAATCTCATAGAGATGAATACCAGCTGTCGCATGATCTGACKGAGATAGTCCTTCAGTTTCCTTCCACGGCATCACAGCTAACGGCACGACTAAGTCGCAGCTGTATGAAAATTGACCACTGCGTCATAGAATATAGACAGCAGGTTCCGATTAACGCCTCTGGGTCGGTCATTGTGGAGATTCATGACCAAAGAATGACGGATAACGAGTCATTACAAGCATCTTGGACATTTCCAATACGATGCAACATAGACCTACATTACTTCTCGTCGTCATTCTTTTCACTGAAGGACCCCATTCCATGGAGATTATACTACCGAGTGTCCGACACAAATGTACATCAAAGGACTCATTTTGCCAAGTTCAAAGGCAAGCTAAAACTCTCAACAGCTAAGCACTCGGTAGATATACCATTCCGGGCTCCCACTGTCAAAATACTATCTAAACAATTCTCCCATAACGATGTGGACTTCTCCCATGTGGACTATGGCCAGTGGGAGCGCAAAGTCTTACGGTCCAATTCAATGTCAAGGGTTGGGCTTACAGGCCCAATTGAATTGAGGCCAGGTGAGTCATGGGCTTCCAGGAGCACCGTGGGTACAAGTAGTCCTTCAAGGGATTCGAAGATGCACCCCTATAGAGAGCTTCATCAATTGGGCCCAAGCGTATTAGACCCAGGTGATTCCGCATCACAGGTTGGTCTACAAAGAGCCCACTCCAATATAACAATGTCAATGGCCCAATTGAACGAACTTGTTAGGACTACGGTTCACGAATGTATTAGTAACAATTGTAACCCGGCACAGCCGAAGTCTTTGCAATAA
Protein Sequence MEAGLASAPSAFNYLESHRDEYQLSHDLTEIVLQFPSTASQLTARLSRSCMKIDHCVIEYRQQVPINASGSVIVEIHDQRMTDNESLQASWTFPIRCNIDLHYFSSSFFSLKDPIPWRLYYRVSDTNVHQRTHFAKFKGKLKLSTAKHSVDIPFRAPTVKILSKQFSHNDVDFSHVDYGQWERKVLRSNSMSRVGLTGPIELRPGESWASRSTVGTSSPSRDSKMHPYRELHQLGPSVLDPGDSASQVGLQRAHSNITMSMAQLNELVRTTVHECISNNCNPAQPKSLQ

NCBI Accession NP_671472.1
Location 208-963
Gene Name CP
Protein Name coat protein
Coding Region ATGGTTAAGCGGGATGCCCCATGGCGTTTAATGGCGGGGACCTCTAAGGTTTCCGGCTCTGCGAATTATTCACGTGGCACGGGTATGGGGCCTAAATTCGATAAGGCCGCTGCTTGGGTTAACAGGCCCATGTACAGGAAGCCCAGTATATATCGTACGTATAGAAGCCCAGATGTGCCTAGASSATGTGAAGGGCCATGTAAGGTCCAGTCCTTCGAGCAGCGGCATGATATCTCGCATGTTGGCAAGGTCATGTGCATTTCTGACGTGACACGTGGTAATGGTATTACCCATCGTGTAGGCAAGCGTTTCTGCGTCAAGTCTGCATACGTTCTGGGTAAGATATGGATGGACGAGAATATCAAGCTCAAGAACCACACCAACAGCGTCATGTTCTGGCTCGTGAGAGATAGGAGACCATATGGTACCCCTATGGACTTTGGTCAGGTGTTCAACATGTATGACAACGAGCCCAGTACAGCTACTGTGAAGAACGATTTGCGTGATCGTTTCCAAGTCATGCACAGGTTCTCGGCTAAGGTCACAGGTGGACAGTATGCCAGCAACGAGCAGGCATTGGTTAGGCGTTTCTGGAAGGTGAACAACTACGTCGTGTACAACCATCAGGAAGCTGGCAAATACGAGAATCATACTGAGAACGCCCTGCTATTGTATATGGCATGTACACATGCCTCTAACCCTGTGTACGCGACATTGAAAATTCGAATCTATTTTTATGATTCGATAACAAATTAA
Protein Sequence MVKRDAPWRLMAGTSKVSGSANYSRGTGMGPKFDKAAAWVNRPMYRKPSIYRTYRSPDVPRXCEGPCKVQSFEQRHDISHVGKVMCISDVTRGNGITHRVGKRFCVKSAYVLGKIWMDENIKLKNHTNSVMFWLVRDRRPYGTPMDFGQVFNMYDNEPSTATVKNDLRDRFQVMHRFSAKVTGGQYASNEQALVRRFWKVNNYVVYNHQEAGKYENHTENALLLYMACTHASNPVYATLKIRIYFYDSITN

NCBI Accession NP_671473.1
Location 960-1358
Gene Name AL3
Protein Name AL3 protein
Coding Region ATGGATTCACGCACAGGGGAGAGCATCACTGTGCATCAGGCAGAGAATTCCGTTTTTATTTGGGAGGTTCCAAATCCCCTATTTTTCAGGATACAGCACGTGGAGGACCCGTTGTTCACCAGAACCAGGATATACCACATCGTAGTCCGGTTCAACCACAACCTACGTCGAGCATTAGCTCTCCACAAGGCATTCCTCCATTTCCAAGTCTGGACGACTTCGATGACAGCTTCTGGGACGACATATTTAAGTAGATTCAAATTTCGCGTCATGTTGTATTTACATACGCTAGGGGCCATAGGCATAAACAATGTAATCAGAGCTGTTCGTTTTGCGACGGACAAATCCTATGTAAATTATGTACTTGAGAATCATGAAATAAAATGCAAACTTTATTAA
Protein Sequence MDSRTGESITVHQAENSVFIWEVPNPLFFRIQHVEDPLFTRTRIYHIVVRFNHNLRRALALHKAFLHFQVWTTSMTASGTTYLSRFKFRVMLYLHTLGAIGINNVIRAVRFATDKSYVNYVLENHEIKCKLY

NCBI Accession NP_671474.1
Location 1105-1494
Protein Name trap
Coding Region ATGCTCAATTCGTCATCCTCCACGCTCCCCTCTATAAAAGCACAGCACAGGATAGCTAAGAAGCGACCTATTCGCAGACGACGCATAGACCTAAACTGCGGCTGCTCTATCTTTCTCCACATCAACTGCGCTAATAATGGATTCACGCACAGGGGAGAGCATCACTGTGCATCAGGCAGAGAATTCCGTTTTTATTTGGGAGGTTCCAAATCCCCTATTTTTCAGGATACAGCACGTGGAGGACCCGTTGTTCACCAGAACCAGGATATACCACATCGTAGTCCGGTTCAACCACAACCTACGTCGAGCATTAGCTCTCCACAAGGCATTCCTCCATTTCCAAGTCTGGACGACTTCGATGACAGCTTCTGGGACGACATATTTAAGTAG
Protein Sequence MLNSSSSTLPSIKAQHRIAKKRPIRRRRIDLNCGCSIFLHINCANNGFTHRGEHHCASGREFRFYLGGSKSPIFQDTARGGPVVHQNQDIPHRSPVQPQPTSSISSPQGIPPFPSLDDFDDSFWDDIFK

NCBI Accession NP_671475.1
Location 1436-2482
Gene Name REP
Protein Name Rep
Coding Region ATGCCACTACCACCAAAATCCTTTCGTTTACAATGTAAAAACATTTTCTTAACATATCCACAATGCGATATCCCAAAGGATGAAGCTCTCGAAATGCTCCGTAATTTAAAATGGGCAGTGGTAAAACCCATCTATCTCCGGGTATCACGAGAGGAGCATTCCGATGGGTTCCCGCACTTGCACTGTCTAATCCAGTTGACTGGAAAATGCAACATCAAAGATGCCCGGTTCTTCGACATTACTCACCCCCGGAGATCTGCCCAGTTTCATCCAAACGTTCAGGCATCCAAGGACGCAAATGCCGTTAAAAATTACATAACAAAAGATGGTGATTATTGTGAATCTGGGCAGTACAAAGTTTCCGGGGGGTCAAAAGCAAATAAAGACGACGTCTACCATAACGCTGTAAATGCTGCAAGTGCGGGGGAGGCGCTCGACATAATCAAAGCTGGTGATCCGAAAACGTTCATTGTTAGTTATCATAACATAAAGGCTAACATCGAGCGCCTATTTACAACTCCTCCTATGCCATGGACTCCTCCTTATCCATTATCCTCGTTTAACAACGTTCCTGAGGATATGCAACATTGGGTTGCTGAATATTTTGGTCGGAGTTGTGCGCGGCCAGATAGACCGATTAGTATTGTCATTGAGGGTGATTCGCGATGCGGCAAGACAATGTGGGCACGTGCACTAGGCCCACATAATTATTTGAGCGGTCATCTTGATTTCAATGCAAAGGTCTATTCAAACTATGTGGAGTATAACGTCATTGATGATATCACGCCCCAATATCTAAAGATGAAACACTGGAAAGAGCTTATTGGGGCCCAAAAAGACTGGCAGTCCAACTGTAAATACGGAAAGCCAGTTCAAATTAAAGGCGGGATACCATCAATCGTGCTGTGCAATCCAGGGGAAGGTAGCAGCTATATAGCTTTCCTCAACAAAGAGGAAAATGCAGAATTAAGAGCGTGGACATTAAAAAATGCTCAATTCGTCATCCTCCACGCTCCCCTCTATAAAAGCACAGCACAGGATAGCTAA
Protein Sequence MPLPPKSFRLQCKNIFLTYPQCDIPKDEALEMLRNLKWAVVKPIYLRVSREEHSDGFPHLHCLIQLTGKCNIKDARFFDITHPRRSAQFHPNVQASKDANAVKNYITKDGDYCESGQYKVSGGSKANKDDVYHNAVNAASAGEALDIIKAGDPKTFIVSYHNIKANIERLFTTPPMPWTPPYPLSSFNNVPEDMQHWVAEYFGRSCARPDRPISIVIEGDSRCGKTMWARALGPHNYLSGHLDFNAKVYSNYVEYNVIDDITPQYLKMKHWKELIGAQKDWQSNCKYGKPVQIKGGIPSIVLCNPGEGSSYIAFLNKEENAELRAWTLKNAQFVILHAPLYKSTAQDS

References More References in PubMed

1

Genetic and Phenotypic Variation of the Pepper golden mosaic virus Complex.

Brown JK, et al.  Phytopathology. 2005 Oct;95(10):1217-24. doi: 10.1094/PHYTO-95-1217.

PMID: 18943475

2

Benzothiadiazole (BTH) induces resistance to Pepper golden mosaic virus (PepGMV) in pepper (Capsicum annuum L.).

Trejo-Saavedra DL, et al.  Biol Res. 2013;46(4):333-40. doi: 10.4067/S0716-97602013000400004.

PMID: 24510135

3

Pepper huasteco virus and Pepper golden mosaic virus are Geminiviruses Affecting Tomatillo (Physalis ixocarpa) Crops in Mexico.

Méndez-Lozano J, et al.  Plant Dis. 2001 Dec;85(12):1291. doi: 10.1094/PDIS.2001.85.12.1291A.

PMID: 30831814

4

RNAi activation with homologous and heterologous sequences that induce resistance against the begomovirus Pepper golden mosaic virus (PepGMV).

Vargas-Salinas M, et al.  3 Biotech. 2021 Mar;11(3):114. doi: 10.1007/s13205-021-02653-7. Epub 2021 Feb 3.

PMID: 33604230

5

Pepper golden mosaic virus Affecting Tomato Crops in the Baja California Peninsula, Mexico.

Holguín-Peña RJ, et al.  Plant Dis. 2004 Feb;88(2):221. doi: 10.1094/PDIS.2004.88.2.221A.

PMID: 30812435

6

Interactions Between Geminiviruses in a Naturally Occurring Mixture: Pepper huasteco virus and Pepper golden mosaic virus.

Méndez-Lozano J, et al.  Phytopathology. 2003 Mar;93(3):270-7. doi: 10.1094/PHYTO.2003.93.3.270.

PMID: 18944336

7

Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica.

Castro RM, et al.  Plant Pathol J. 2013 Sep;29(3):285-93. doi: 10.5423/PPJ.OA.12.2012.0182.

PMID: 25288955

8

A Begomovirus Associated with Leaf Curling and Chlorosis of Soybean in Sinaloa, Mexico is Related to Pepper golden mosaic virus.

Méndez-Lozano J, et al.  Plant Dis. 2006 Jan;90(1):109. doi: 10.1094/PD-90-0109B.

PMID: 30786488

9

Symptom Remission and Specific Resistance of Pepper Plants After Infection by Pepper golden mosaic virus.

Carrillo-Tripp J, et al.  Phytopathology. 2007 Jan;97(1):51-9. doi: 10.1094/PHYTO-97-0051.

PMID: 18942936

10

Microarray analysis of tomato plants exposed to the nonviruliferous or viruliferous whitefly vector harboring Pepper golden mosaic virus.

Musser RO, et al.  J Insect Sci. 2014 Jan 1;14:230. doi: 10.1093/jisesa/ieu092. Print 2014.

PMID: 25525099