Melon chlorotic mosaic virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_000887515.1
Isolate Venezuela
Release date 2015/2/22
Submitter Romay,G., Chirinos,D., Geraud-Pouey,F., Desbiez,C., Geraud,F.
Host
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_014380
ACTGGATGGCCGACCGTTTTTTGGAGTCCTGCCTTTACGCATGGGGCGCTCCTTTCCTGGTCATTACATTAGGGACCACCAAATGTTGATAACGACATCAGACCAATCAGATTGTTTCTGGCGCGTCTATTTACCAATGACTTGTTAACCAAGTGGCTATAAAGGAAGGCGAGTTGTCATGTCATGTCAGCTTTAATTCAAAATGGTGAAGCGCGATGCTCCATGGCGGATGATGGCGGGGACCGCAAAGGTATCTCGATCTGCGAATTATTCTCCGCGTGCAGGTTTGGGCCCCAAATTTGACAAGGCCCATGCCTGGGTAAACCGGCCTATGTACAGAAAGCCCAGGATCTACCGGACGTTGAGAGGTGCCGACGTTCCCAAAGGATGTGAAGGCCCTTGTAAGGTTCAGTCTTACGAACAGCGTCATGATATTTCTCATGTTGGGAAGGTTATGTGCATTTCTGACGTTACTCGTGGTAACGGTATTACTCATCGTGTTGGTAAACGTTTTTGTGTTAAGTCTGTATATATTATAGGTAAGGTTTGGATGGACGATAACATCAAGTTGAAGAACCACACCAATAGCGTTATGTTTTGGTTAGTCAGAGATCGGCGACCGTATGGCACCCCCATGGAATTTGGGCAAGTGTTCAACATGTACGATAACGAGCCTAGTACTGCAACGATCAAGAACGATCTGCGTGATCGTTTTCAAGTCATGCATCGGTTTTATTCTAAGGTGACCGGGGGACAATATGCGAGCAACGAGCAAGCTCTCGTCCGGCGTTTTTGGAAGGTTAACAACTACGTCGTCTACAATCATCAGGAAGCCGCTAAATACGAGAATCATACCGAGAATGCTTTGTTATTGTATATGGCATGTACTCATGCTTCTAACCCTGTGTATGCGACATTGAAAATTCGGATCTATTTTTACGATTCGATAACAAATTAATAAAACTTGAATTTTATTACATGATTCTCAAGTACATCTGTTACATATTTTCTGTTTGTGGCGAAACGAACAGCCCTTACAACATTATTCAGACCGATAACCCCTAACATGTTCAAGTAATGCATTACAACATGTTTAAACCTATTTAAATAAGTCGTCCCAGAAGCTGTCAGTGAAGTCGTCCAGATTTGGAAGTTGAGAAAAGCTTGGTGTAGATCCAGTGCCTTCCTCAAGTTGTGGTTGAACCTGATTTGTATGTGGTAAATTCTGGTTCTTGTGTATATCGGTTGTTCGACGTGGTATATTTTGAAAAACAGGGGATTTGGAACCGTCCAGATAAAAACGGAATTCTCTGCCTGATAGACAGTGATGCTCTCCCCCGTGCGTGAATCCATTTTCTGCGCAGGCAATATGTACGAAAATTGAACAGCCGCAGTTTAGGTCAATGCGCCTTCTACGAACGCCCTTCTTCTTGGCTATTCTGTGCTTCGTCTTGATAGAGGGGGGCGTTGAGGAAGACGAAGTTAGCATTTTTTAACGTCCACGCTCTTAGAGATGCATTTTCCTCTTTGTCAAGAAATGCTTTATAACTGGCCCCATCCCCTGGATTGCACAGCACGATTGATGGGATGCCGCCTTTAATTTTAACCGGCTTTCCGTACTTACAGTTGGATTGCCAGTCTCTTTGGGCCCCAATCAATTCTTTCCAATGCTTTAACTTTAGATATTGCGGTCCAACGTCATCGATGACGTTATACATCACATTATTAGAGTAAACCCTAGCATTGAAGTCGAGATGACCACTTAAATAATTATGCGGACCTATAGCACGAGCCCACATTGTCTTGCCCGTACGACTATCACCCTCTATGATTATACTTCTAGGTCTTACCGGCCCCGCAGGGGTCATACAAGCGGCCCGCGCAGCGGTTACATTCTCATCGACCCAGTCTTTCATCTCTTGTGGAACGTTGTTGAACGACGACAACTGAAATGGAGGAACCCATGGATCCTCATCCTTTTGGAAGAGGCGCTCGATGTTGGCTTTAACATTATGATAATTTACAACAAATGTTTTTGGATCACCCGCTTTTATAATTGCGAGAGCCTCTTCTGCAGTTCCGGCATTGATGGCATTATGGAACACGTCGTCTTTATTGGACTTTGTACCCCCAGACACCTTATATTCGCCGGATTCACAATAATCACCTTCTTTGGTGATGTAATTCTTGACGGCGTTGGAGTCTTTGGCTGCCTGAATGTTTGGGTGAAAACAGGCAGACCTTCTGGGGTGAGTAAGGTCGAAAAATCTTGCATTCTTGATGTTCGACTTTCCGGATAACTGTATGAGACAGTGTAGGTGTGGAGAGCCGTCGGAGTGTTCCTCTCTTGCGACTCTGATATATTTCGGTTTGACAACTGTCCATGCCAGTTCTTGAAGCATCTTAAGAGCTTCATCCTTTGGGATGTCGCACTGAGGATATGTTAAGAAAATGTTTTTTGCTGCGACCCGAAATGATTTAGGACTTCTAGGCATATTTGAAGAATAAGTGGAGACACCAGCGGAGTCCGCTTCTAAAACCTATTGTTTATGGTGTCTTGGTGTCTCATATATACTATAACTCATAAAGGGTCTTATAGGGGTAAAATCGGCCATCCACAATAATATT

NC_014381
ACTGGATGGCCGCCCGAGTTTGGTGCCTCTATCCGTACTGCCACGTGCTTCTCCCTCATTGGTGATATCCCCTATTGGTGCCGGCCCATCTCCTTCCGTTGGTGCCCAGGCCCAGGCCCAAATCTTTATTTAAGTTTATTGTCGTCCTCGTCCACTATCCTTTACTGTCGACCAATGAGAATTCGTTTTCAGAGTCTTCGTAATGACAACGGCTGACCGGAGATAGTGGAGATCCTTTTCAGCCTTATGTCAGTATCAGCTTTAAACTTTAATTTGAAATGCATTGGCGCATTTGTTAGTGCGATAGTGGTCCCATTTATCCGACATATCCTCAGTGCGTTCTGCAGAACGATGACATGGACCAATAAAATATTAGATATGAAGCTTATTAGATTGACCTATTCTTTGCGGATCGTTATATAACGATGTTGTTGTCGACGTTTTCCAACAAGACTAATATTTTAATTCAGTAATAAAATATGTACGCAATCAAGAACAGAAGAGTTTGGTATTCTACACATCGTCGGGGTTATGGACAACGTAGTTATAATAAACGTACATATTCTGGTAAGCGTACCGATTGGAAACGCCGTCCAATTATTCCTAATAATTCCAGCGATGATACTAGGATTGTTTCCCAACGTATCCACGAAGATCAATTTGGACCGGAGTTTGTGATCCCACATAATACGGCTCTATCAACCTTTTTGACAATGCCGAGTATTGTGAAACTTCAACCTAACCGTTCTAGGGATTACATTAAATTAAAACGACTCCGTTATAAAGGTACGCTTAAGATCGAGAGTGTTAATGCTGATGTGAACATGGGTTGTGTCAATTCTAAGATTGACGGAGTGTTTTCTCTGGTTATTGTGATTGACCGTAAACCTCATCTTAACGGATCTGGACGTCTACATACATTTGATGAACTATTTGGCGCAAGGATTCACAGTCATGGGAATCTATCTATAGCACCAGCAATGAAAGAGCGTTATTACATACGACACGTGTTCAAGCGCGTTTTGTCCACTGAGAAGGACAGTTTGATGACTGATATTGAGGGAAGCGCATTATTGTCTAATAGGCGCTTTAGTTGTTGGTCTGCGTTTAATGATGTAGACAGAGAATCATGTAACGGCGTTTACGCTAACATTAACAAGAACGCAATTTTGATTTATTACTGTTGGATGTCCGATGCTATTACGAAGGCATCCACATTTGTATCGTTTGATTTGGATTATTGTGGCTGATTAATAAAATTGTTATTCAATAACCGTTATCATACAACATATATTTTGGAATTTACAGTGTTGAACACTAACATACATGACTCATCTTAATTTAAAGATTTGGGGTCATTTGGGGTACAGTTACTCTTAATACACTCCTGCACGGTTGATCTTACGATATCATTTAACTGTGATAGTGACAGCGTTATGTTCGATTGCGTCCTTTGCATTCCTACTATTGATGCCGACTCTCCCGGGTCTAGAATGGGCGTGTTTAATCTATGTAGCTCTCTGTATGGATGCAATTCCTCTGCATCATCTGACTCCGTAATGGATTGGGCTGGGCCCAAAGTACTTCTACTAGCCCATGATTCACCGGGCCTTAGATCGATTGGTCCAAGAAGACCTTGCCGACATGTTGACATTGACCTGACGAGCTTTCGTTCCCATTTACCGTATCCGACGTGGCTGAAATCGACGTCTTTTGCGGAAAACAGTTTCGATAATATCTTTACCGTCGGTGCCCGGAACGGTATATCAACGGAATGTTTCGCCGTCGATAATTTCAGTTTTCCCTTGAACTTGGCGAAATGCGTACCATGATGAACATTTGAGTCGCTAACTCTGTAGTACAGCACCCATGGTATTGGGTCTTTCAGCGAAAAGAAAGAAGAAGAGAAATAGTGGAGATCTATGTTGCATCTGATCGGGAACGTCCAGGACGCTTGTAAGGATTGATCGTCCGTCATCCGCTTGTCGTGGATTTCGACGATAACCGTTCCCGACGCGTTGATCGGCACTTGTTGCCTGTATTCTACGACGCAGTGGTCGATTTTCATACAGCTTCTCGTCAGTCTAGCACTTATTTGAGCCGTGGTCGACGGAAATTGCAACACGATTTGGGTTAAATCATGCGATAACTGATATTCATCACGATTCGACTCGATATAGTTAAAGGCATTAGGAGGATCAGCCAATTTAGAATTCATCTATTTAATTAGGCCCCGCAGGGGTCGTCACACAGGCCGCGCAGTCGGGTCGTTTAAATTCCGACCTCTAGTTGAACTTCGACCAGAAGAAGACGATAGTCGTTTACGGCAGAGAAATTTCAGAGATGATGGACAGGAATTTGATTTCTATTTAATGATATCACATCCGAGAAATTTCAGAGAAGATGAACATTAATTTGATTTCTACTTACCGATATGACCTCATTTATAGTGGAACTAGGGTTTTGTGGCATATTCTGTAAATTGGGGTGAAGACACCAGCGGAGTCCTCTTCTAAAACCTATTGTTTATGGTGTCTTGGTGTCTCATATATACTATAAGTCTATAAGGTTCTTAAAGGGGTAAAATCGGCCATCCACAATAATATT

Gene Information

NCBI Accession YP_003828904.1
Location 203-958
Protein Name AV1
Coding Region ATGGTGAAGCGCGATGCTCCATGGCGGATGATGGCGGGGACCGCAAAGGTATCTCGATCTGCGAATTATTCTCCGCGTGCAGGTTTGGGCCCCAAATTTGACAAGGCCCATGCCTGGGTAAACCGGCCTATGTACAGAAAGCCCAGGATCTACCGGACGTTGAGAGGTGCCGACGTTCCCAAAGGATGTGAAGGCCCTTGTAAGGTTCAGTCTTACGAACAGCGTCATGATATTTCTCATGTTGGGAAGGTTATGTGCATTTCTGACGTTACTCGTGGTAACGGTATTACTCATCGTGTTGGTAAACGTTTTTGTGTTAAGTCTGTATATATTATAGGTAAGGTTTGGATGGACGATAACATCAAGTTGAAGAACCACACCAATAGCGTTATGTTTTGGTTAGTCAGAGATCGGCGACCGTATGGCACCCCCATGGAATTTGGGCAAGTGTTCAACATGTACGATAACGAGCCTAGTACTGCAACGATCAAGAACGATCTGCGTGATCGTTTTCAAGTCATGCATCGGTTTTATTCTAAGGTGACCGGGGGACAATATGCGAGCAACGAGCAAGCTCTCGTCCGGCGTTTTTGGAAGGTTAACAACTACGTCGTCTACAATCATCAGGAAGCCGCTAAATACGAGAATCATACCGAGAATGCTTTGTTATTGTATATGGCATGTACTCATGCTTCTAACCCTGTGTATGCGACATTGAAAATTCGGATCTATTTTTACGATTCGATAACAAATTAA
Protein Sequence MVKRDAPWRMMAGTAKVSRSANYSPRAGLGPKFDKAHAWVNRPMYRKPRIYRTLRGADVPKGCEGPCKVQSYEQRHDISHVGKVMCISDVTRGNGITHRVGKRFCVKSVYIIGKVWMDDNIKLKNHTNSVMFWLVRDRRPYGTPMEFGQVFNMYDNEPSTATIKNDLRDRFQVMHRFYSKVTGGQYASNEQALVRRFWKVNNYVVYNHQEAAKYENHTENALLLYMACTHASNPVYATLKIRIYFYDSITN

NCBI Accession YP_003828905.1
Location 955-1353
Protein Name AC3
Coding Region ATGGATTCACGCACGGGGGAGAGCATCACTGTCTATCAGGCAGAGAATTCCGTTTTTATCTGGACGGTTCCAAATCCCCTGTTTTTCAAAATATACCACGTCGAACAACCGATATACACAAGAACCAGAATTTACCACATACAAATCAGGTTCAACCACAACTTGAGGAAGGCACTGGATCTACACCAAGCTTTTCTCAACTTCCAAATCTGGACGACTTCACTGACAGCTTCTGGGACGACTTATTTAAATAGGTTTAAACATGTTGTAATGCATTACTTGAACATGTTAGGGGTTATCGGTCTGAATAATGTTGTAAGGGCTGTTCGTTTCGCCACAAACAGAAAATATGTAACAGATGTACTTGAGAATCATGTAATAAAATTCAAGTTTTATTAA
Protein Sequence MDSRTGESITVYQAENSVFIWTVPNPLFFKIYHVEQPIYTRTRIYHIQIRFNHNLRKALDLHQAFLNFQIWTTSLTASGTTYLNRFKHVVMHYLNMLGVIGLNNVVRAVRFATNRKYVTDVLENHVIKFKFY

NCBI Accession YP_003828906.1
Location 1100-1489
Protein Name AC2
Coding Region ATGCTAACTTCGTCTTCCTCAACGCCCCCCTCTATCAAGACGAAGCACAGAATAGCCAAGAAGAAGGGCGTTCGTAGAAGGCGCATTGACCTAAACTGCGGCTGTTCAATTTTCGTACATATTGCCTGCGCAGAAAATGGATTCACGCACGGGGGAGAGCATCACTGTCTATCAGGCAGAGAATTCCGTTTTTATCTGGACGGTTCCAAATCCCCTGTTTTTCAAAATATACCACGTCGAACAACCGATATACACAAGAACCAGAATTTACCACATACAAATCAGGTTCAACCACAACTTGAGGAAGGCACTGGATCTACACCAAGCTTTTCTCAACTTCCAAATCTGGACGACTTCACTGACAGCTTCTGGGACGACTTATTTAAATAG
Protein Sequence MLTSSSSTPPSIKTKHRIAKKKGVRRRRIDLNCGCSIFVHIACAENGFTHGGEHHCLSGREFRFYLDGSKSPVFQNIPRRTTDIHKNQNLPHTNQVQPQLEEGTGSTPSFSQLPNLDDFTDSFWDDLFK

NCBI Accession YP_003828907.1
Location 1413-2495
Protein Name AC1
Coding Region ATGCCTAGAAGTCCTAAATCATTTCGGGTCGCAGCAAAAAACATTTTCTTAACATATCCTCAGTGCGACATCCCAAAGGATGAAGCTCTTAAGATGCTTCAAGAACTGGCATGGACAGTTGTCAAACCGAAATATATCAGAGTCGCAAGAGAGGAACACTCCGACGGCTCTCCACACCTACACTGTCTCATACAGTTATCCGGAAAGTCGAACATCAAGAATGCAAGATTTTTCGACCTTACTCACCCCAGAAGGTCTGCCTGTTTTCACCCAAACATTCAGGCAGCCAAAGACTCCAACGCCGTCAAGAATTACATCACCAAAGAAGGTGATTATTGTGAATCCGGCGAATATAAGGTGTCTGGGGGTACAAAGTCCAATAAAGACGACGTGTTCCATAATGCCATCAATGCCGGAACTGCAGAAGAGGCTCTCGCAATTATAAAAGCGGGTGATCCAAAAACATTTGTTGTAAATTATCATAATGTTAAAGCCAACATCGAGCGCCTCTTCCAAAAGGATGAGGATCCATGGGTTCCTCCATTTCAGTTGTCGTCGTTCAACAACGTTCCACAAGAGATGAAAGACTGGGTCGATGAGAATGTAACCGCTGCGCGGGCCGCTTGTATGACCCCTGCGGGGCCGGTAAGACCTAGAAGTATAATCATAGAGGGTGATAGTCGTACGGGCAAGACAATGTGGGCTCGTGCTATAGGTCCGCATAATTATTTAAGTGGTCATCTCGACTTCAATGCTAGGGTTTACTCTAATAATGTGATGTATAACGTCATCGATGACGTTGGACCGCAATATCTAAAGTTAAAGCATTGGAAAGAATTGATTGGGGCCCAAAGAGACTGGCAATCCAACTGTAAGTACGGAAAGCCGGTTAAAATTAAAGGCGGCATCCCATCAATCGTGCTGTGCAATCCAGGGGATGGGGCCAGTTATAAAGCATTTCTTGACAAAGAGGAAAATGCATCTCTAAGAGCGTGGACGTTAAAAAATGCTAACTTCGTCTTCCTCAACGCCCCCCTCTATCAAGACGAAGCACAGAATAGCCAAGAAGAAGGGCGTTCGTAG
Protein Sequence MPRSPKSFRVAAKNIFLTYPQCDIPKDEALKMLQELAWTVVKPKYIRVAREEHSDGSPHLHCLIQLSGKSNIKNARFFDLTHPRRSACFHPNIQAAKDSNAVKNYITKEGDYCESGEYKVSGGTKSNKDDVFHNAINAGTAEEALAIIKAGDPKTFVVNYHNVKANIERLFQKDEDPWVPPFQLSSFNNVPQEMKDWVDENVTAARAACMTPAGPVRPRSIIIEGDSRTGKTMWARAIGPHNYLSGHLDFNARVYSNNVMYNVIDDVGPQYLKLKHWKELIGAQRDWQSNCKYGKPVKIKGGIPSIVLCNPGDGASYKAFLDKEENASLRAWTLKNANFVFLNAPLYQDEAQNSQEEGRS

NCBI Accession YP_003828908.1
Location 2051-2416
Protein Name AC4
Coding Region ATGAAGCTCTTAAGATGCTTCAAGAACTGGCATGGACAGTTGTCAAACCGAAATATATCAGAGTCGCAAGAGAGGAACACTCCGACGGCTCTCCACACCTACACTGTCTCATACAGTTATCCGGAAAGTCGAACATCAAGAATGCAAGATTTTTCGACCTTACTCACCCCAGAAGGTCTGCCTGTTTTCACCCAAACATTCAGGCAGCCAAAGACTCCAACGCCGTCAAGAATTACATCACCAAAGAAGGTGATTATTGTGAATCCGGCGAATATAAGGTGTCTGGGGGTACAAAGTCCAATAAAGACGACGTGTTCCATAATGCCATCAATGCCGGAACTGCAGAAGAGGCTCTCGCAATTATAA
Protein Sequence MKLLRCFKNWHGQLSNRNISESQERNTPTALHTYTVSYSYPESRTSRMQDFSTLLTPEGLPVFTQTFRQPKTPTPSRITSPKKVIIVNPANIRCLGVQSPIKTTCSIMPSMPELQKRLSQL

NCBI Accession YP_003828909.1
Location 480-1250
Protein Name BV1
Coding Region ATGTACGCAATCAAGAACAGAAGAGTTTGGTATTCTACACATCGTCGGGGTTATGGACAACGTAGTTATAATAAACGTACATATTCTGGTAAGCGTACCGATTGGAAACGCCGTCCAATTATTCCTAATAATTCCAGCGATGATACTAGGATTGTTTCCCAACGTATCCACGAAGATCAATTTGGACCGGAGTTTGTGATCCCACATAATACGGCTCTATCAACCTTTTTGACAATGCCGAGTATTGTGAAACTTCAACCTAACCGTTCTAGGGATTACATTAAATTAAAACGACTCCGTTATAAAGGTACGCTTAAGATCGAGAGTGTTAATGCTGATGTGAACATGGGTTGTGTCAATTCTAAGATTGACGGAGTGTTTTCTCTGGTTATTGTGATTGACCGTAAACCTCATCTTAACGGATCTGGACGTCTACATACATTTGATGAACTATTTGGCGCAAGGATTCACAGTCATGGGAATCTATCTATAGCACCAGCAATGAAAGAGCGTTATTACATACGACACGTGTTCAAGCGCGTTTTGTCCACTGAGAAGGACAGTTTGATGACTGATATTGAGGGAAGCGCATTATTGTCTAATAGGCGCTTTAGTTGTTGGTCTGCGTTTAATGATGTAGACAGAGAATCATGTAACGGCGTTTACGCTAACATTAACAAGAACGCAATTTTGATTTATTACTGTTGGATGTCCGATGCTATTACGAAGGCATCCACATTTGTATCGTTTGATTTGGATTATTGTGGCTGA
Protein Sequence MYAIKNRRVWYSTHRRGYGQRSYNKRTYSGKRTDWKRRPIIPNNSSDDTRIVSQRIHEDQFGPEFVIPHNTALSTFLTMPSIVKLQPNRSRDYIKLKRLRYKGTLKIESVNADVNMGCVNSKIDGVFSLVIVIDRKPHLNGSGRLHTFDELFGARIHSHGNLSIAPAMKERYYIRHVFKRVLSTEKDSLMTDIEGSALLSNRRFSCWSAFNDVDRESCNGVYANINKNAILIYYCWMSDAITKASTFVSFDLDYCG

NCBI Accession YP_003828910.1
Location 1337-2218
Protein Name BC2
Coding Region ATGAATTCTAAATTGGCTGATCCTCCTAATGCCTTTAACTATATCGAGTCGAATCGTGATGAATATCAGTTATCGCATGATTTAACCCAAATCGTGTTGCAATTTCCGTCGACCACGGCTCAAATAAGTGCTAGACTGACGAGAAGCTGTATGAAAATCGACCACTGCGTCGTAGAATACAGGCAACAAGTGCCGATCAACGCGTCGGGAACGGTTATCGTCGAAATCCACGACAAGCGGATGACGGACGATCAATCCTTACAAGCGTCCTGGACGTTCCCGATCAGATGCAACATAGATCTCCACTATTTCTCTTCTTCTTTCTTTTCGCTGAAAGACCCAATACCATGGGTGCTGTACTACAGAGTTAGCGACTCAAATGTTCATCATGGTACGCATTTCGCCAAGTTCAAGGGAAAACTGAAATTATCGACGGCGAAACATTCCGTTGATATACCGTTCCGGGCACCGACGGTAAAGATATTATCGAAACTGTTTTCCGCAAAAGACGTCGATTTCAGCCACGTCGGATACGGTAAATGGGAACGAAAGCTCGTCAGGTCAATGTCAACATGTCGGCAAGGTCTTCTTGGACCAATCGATCTAAGGCCCGGTGAATCATGGGCTAGTAGAAGTACTTTGGGCCCAGCCCAATCCATTACGGAGTCAGATGATGCAGAGGAATTGCATCCATACAGAGAGCTACATAGATTAAACACGCCCATTCTAGACCCGGGAGAGTCGGCATCAATAGTAGGAATGCAAAGGACGCAATCGAACATAACGCTGTCACTATCACAGTTAAATGATATCGTAAGATCAACCGTGCAGGAGTGTATTAAGAGTAACTGTACCCCAAATGACCCCAAATCTTTAAATTAA
Protein Sequence MNSKLADPPNAFNYIESNRDEYQLSHDLTQIVLQFPSTTAQISARLTRSCMKIDHCVVEYRQQVPINASGTVIVEIHDKRMTDDQSLQASWTFPIRCNIDLHYFSSSFFSLKDPIPWVLYYRVSDSNVHHGTHFAKFKGKLKLSTAKHSVDIPFRAPTVKILSKLFSAKDVDFSHVGYGKWERKLVRSMSTCRQGLLGPIDLRPGESWASRSTLGPAQSITESDDAEELHPYRELHRLNTPILDPGESASIVGMQRTQSNITLSLSQLNDIVRSTVQECIKSNCTPNDPKSLN

References More References in PubMed

1

Resistance Against Melon Chlorotic Mosaic Virus and Tomato Leaf Curl New Delhi Virus in Melon.

Romay G, et al.  Plant Dis. 2019 Nov;103(11):2913-2919. doi: 10.1094/PDIS-02-19-0298-RE. Epub 2019 Aug 20.

PMID: 31436474

2

First report of Cucurbit chlorotic yellows virus infecting Cucumis melo (muskmelon and oriental melon) in Korea.

Cho IS, et al.  Plant Dis. 2021 Feb 2. doi: 10.1094/PDIS-11-20-2375-PDN. Online ahead of print.

PMID: 33529069

3

First Report of Cucumber mosaic virus on Melon in Bosnia and Herzegovina.

Trkulja V, et al.  Plant Dis. 2013 Aug;97(8):1124. doi: 10.1094/PDIS-02-13-0135-PDN.

PMID: 30722492

4

Snake melon asteroid mosaic virus, a Tentative New Member of the Genus Sobemovirus Infecting Cucurbits.

Lecoq H, et al.  Plant Dis. 2011 Feb;95(2):153-157. doi: 10.1094/PDIS-06-10-0447.

PMID: 30743409

5

Melon chlorotic leaf curl virus, a New Begomovirus Associated with Bemisia tabaci Infestations in Guatemala.

Brown JK, et al.  Plant Dis. 2001 Sep;85(9):1027. doi: 10.1094/PDIS.2001.85.9.1027C.

PMID: 30823088

6

Occurrence of Ourmia melon virus in the Guilan Province of Northern Iran.

Gholamalizadeh R, et al.  Plant Dis. 2008 Jul;92(7):1135. doi: 10.1094/PDIS-92-7-1135C.

PMID: 30769509

7

First Report of Moroccan watermelon mosaic virus in Zucchini Crops in Greece.

Malandraki I, et al.  Plant Dis. 2014 May;98(5):702. doi: 10.1094/PDIS-10-13-1100-PDN.

PMID: 30708553

8

Sida chlorotic leaf virus: a new recombinant begomovirus found in non-cultivated plants and Cucumis sativus L.

García-Rodríguez DA, et al.  PeerJ. 2023 Mar 22;11:e15047. doi: 10.7717/peerj.15047. eCollection 2023.

PMID: 36974135

9

Melon chlorotic leaf curl virus: characterization and differential reassortment with closest relatives reveal adaptive virulence in the squash leaf curl virus clade and host shifting by the host-restricted bean calico mosaic virus.

Idris AM, et al.  J Virol. 2008 Feb;82(4):1959-67. doi: 10.1128/JVI.01992-07. Epub 2007 Dec 5.

PMID: 18057231

10

First Report of Watermelon Mosaic Virus Naturally Infecting Coriander (Coriandrum sativum) and causing a leaf mottling disease in California.

Cespedes MK, et al.  Plant Dis. 2022 Sep 21. doi: 10.1094/PDIS-05-22-1184-PDN. Online ahead of print.

PMID: 36131502