Melon chlorotic leaf curl virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_001430695.1
Isolate Guatemala
Release date 2015/11/3
Submitter Brown,J.K., Idris,A.M., Rogan,D., Hussein,M.H., Palmieri,M., Mills-Lujan,K., Martin,K.
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_028138
ACCGGATGGCCGCCCTTTTTTGGTGTCCTCCACTTTATTCCCGGGCCTGGACCATCTGCGGTGTGCAGGATGAAAGGCCCAGCCCATCTTGACGTGCGCCTTTACTCTTTATGGGACCACACAGCACAAACAACCAATCATATTCGGAGTTTGTATCTTGTATATCTGCTAATTGTAACACAATGGTGGACCCATGTGAACATTGTGCTGTGTAAGAAACTTCGTCTTTAATTCAAATTGCCAAAGTGGGCATCTCGTCTTTATTTTGAACATTTAAAGAAAGCTGTACGAATGTCAGCTTTAACCCATTACTTCTTCGCTCGGTACCGCATATTAATAATTTGAATTATACTTTATTGTGGCCAATTACATTTCAACTACGTGTCTTGTTAGATGATCAGGACCACGTTATTTGTCTATTTATATGTGCTTCGTGTAATTGGCCTCCACGTCGTATACATGCTTTAGCCACATTGTTTAGTTTATACACGATTGATATCGGGTATAGTATTTAATTTACCTGTTCGTTATGTATTCGGCGAACTATAGACGTACTCGTGGGACTACCCAACGTGGTTCATATTCACGACGTCCAATATTCAAGCGTCCACATTATTTGTCTCGGTCAGATGATAAGCGTCGCACTAATTCGACTATTGTGCCTCATGCCGACACTAAGATGTTAAAACAACGGTTGCATGAGGATCAATTTGGCCCAGATTATGTTTTGTGTCATAATAGTGCGATGTCCACGTTTATTACTCTTCCTAGTCTTGGTAAGCACGAGCCCAATCGTTCAAGGTCGTTTATAAAGTTACAACGACTCCGTTACAAGGGAACTCTGAAAATTGAACGTGGACCTGGTGACACGTTCATGGAAGGTCCCACGTCAAAGGTAGAAGGCGTCTTTTCTATGGTAGTTGTGGTTGATCGTAAACCACATGTTAACCCATCTGGACGCTTACATTCCTTTGATGAGTTATTCGGCGCGCGTATCCATAGTCACGGTAATTTAGCCATAGTCCCGGCATTGAAGGAGCGTTTTTACATTCGCCACGTATTGAAACGAGTATTATCCGTCGAGAAAGACACGTTGATGGTTGATCTACATGGAACAACCGCATTATCTAATAGGCGATTCAATTGTTGGTCCTCGTTTAATGATCTTGAACGCGATTCATGTAACGGCGTTTACGCTAATATAAACAAGAACGCTCTTTTAGTTTATTATTGTTGGATGTCGGATATGCCTTCGAAGGCATCGACATATGTAACGTTTGATCTCGACTATGTCGGATAAATAGGAATATTTTATTGATCAAATATGTTGCCTACCGCCATATATTACAAACAATAATCTTTTACCCAGATCTTTTAATTAAACCCGTAGTTTAATTATCCTATTAAATATGGCCACGCAGTGGAACACTCTCCAAAATGAAGAACAGCAATATTTTCATTAACCAATTATCGTCATGATGTGACAATAAACCTAAATACAATATTATCCTAAGGATTTTGGAGTTGAGGGAATACAACTGGTCTTGATGCACTCCTGAACGGTGGATCTAACTAATTCGTTCAGTTGTGCCATTGACATGGTAATGTTTGATTGCGACCGTTGTATTCCGACCATTGACGCCGATTCTCCAGGGTCTAATATAGATGTACCCAACCTGTTAAGCTCGCGATAGGGAAGCATCTCATCTGTTGTATCCAAGTCCGCATTTAGTGGGCTCGTACCCAGAGCACTTCTAGTGGCCCAAGATTCGCCTGGATTTAATTCAATTGGGCCTCTGAGCCCATATCTTGACATCGATGCGGATTTGACCAGTCTTCTCTCCCATTTGCCGTACCCAACGTGCCAGAAATCGACGTCCTTTTGGCTAAATTGCTTTGTAAGGATTTTGACTGTTGGTGCCCGGAAGGGAATATCGACGGAATGTTTCGCCGACGATAACTTCAATTTACCTTTGAATTTAGCGAAATGAGTCATCTGATGCACGTTCGAGTCTGTTACCCGATAATATAACTTCCAAGGAATGGGATCTTTGAGAGAGAAGAATGATGACGAGAAATAGTGGAGATCTATGTTACATCTGATCGGAAACGTCCACGAGGCTTGTAAGGACTCATTGTCGGTCATTCGTTTATCGTGAATCTCCACTATTACTGTTCCAGATGCGTTGATAGGTACTTGTTGCCTATATTCTATGACACAATGGTCGATCTTCATACAACTCCGACTAAGTCTTGCAGTTAATTGGGAAGTAGTCGACGGAAATTGCAGAATAATTTCCGTTAAGTCGTGCGATAACTGAAATTCATCCCGACTAGACTCTATATAATTGAACGCATTCGGTGGAGGAGCTAATTGAGAACCCATTTAGAGAAACACAAATCTTGTCATGCTAATTCGGAAACGGACACTGCGTATAAATAATAATTCATGACTCGGATATGAGGAACGAAGTTTGTTAGGGTTTCAATGGCATATTTTGTAGATATGATTCGGGACACCAGGAGGAGCTCTCTCTAAAACCTATATTTGTGGTGTCCTGGTGTCCTATATATACTACAAGGCTTCTAGGAGGCTACTAGGACACCAGGGGTAAATTCGGCCATCCGCAATAATATT

NC_004732
ACCGGATGGCCGCCCTTTTTTGGTGTCCTACACTTTATCCCAGGCCCAAGCCCAAAGCAACCACAACCTTTACTTTTCTATGGGACCACTATAATTATTCCAACCTATCAAATCGCTCCAGTACAGTCTATATAATTATGCCTTGGTGAGTCAGCGTGGTCCCTATAAATGAAAGCAGTCTAAACCCATACCTCTTTAATTCGAAATGGTTAAGAGGGATGCCCCATGGCGTTTAATGGCGGGGACCTCCAAGGTTTCCCGCTCTGCTAATTATTCGCCTCGTGGAGGTATGGGCCCTAAATTCAATAAGGCCGCTGCATGGGTTAATAGGCCCATGTACAGGAAGCCCAGAATTTATCGCACGTTACGAGGTCCTGACATCCCCAAAGGATGTGAAGGACCATGCAAGGTTCAATCATTTGAGCAGCGGCATGATATCTCTCATATTGGTAAGGTTATGTGTATTTCTGACGTGACGCGTGGCAATGGTATTACTCACCGCGTCGGCAAGCGTTTTTGTGTTAAGTCTGTATATATTTTAGGCAAGATATGGATGGACGAAAACATCAAGCTGAAGAATCACACAAACAGTGTGATGTTTTGGCTAGTTCGAGATCGGAGACCCTATGGCACTCCTATGGATTTCGGCCAAGTATTCAACATGTTTGACAACGAGCCTAGCACTGCAACCGTTAAGAACGATCTACGAGATCGTTATCAAGTTTTGCACAGGTTTTACGCGAAAGTCACTGGTGGTCAGTATGCTAGCAACGAACAAGCCTTGGTGAGGCGTTTTTGGAAGGTCAACAATTATGTTGTCTACAATCACCAGGAAGCAGCAAAATACGAGAATCATACGGAGAACGCTTTATTATTGTATATGGCATGTACTCATGCATCTAACCCTGTGTACGCGACATTGAAAATTCGGATCTATTTTTATGATTCGATAACAAATTAATAAACGTTGAATTTTATTATATGATTCTCGATTACATAATTTACATATGAACGGTCTGTCGCCCATGATACAGCACGTATGACGTTATTGAGACCGATAACCCCTAATCTATCTAAATACAACATAACTAAATGTTTAAATCTATTTAAATAAGTCGTCCCAGAAGCTCGAATCGATTCCGTCCAGACTTGGAAGTTCAGGTATGCTTTGTGAAGATTTAGCGCTCTCCGCAGGTTGTGGTTGAATCGGATTTGTATGTGGTATATTCTTGTGTGCGTATACAGTGGATCCTCCACTTTGTATATCTTGAAATAGAGGGGATTTGGAACTTCCCAGATAAAAACGGAATTCTCCGCCTGATACACAGTGATGTCTTCCCAAGTGCGTAAATCCATTACCATTTTTTTGGCAGCTAAGATGGAGGAATATGGAACAGCCGCAGTTCAGGTCGATGCGTCTACGACGGATAGCTCTTGTTTTAGCGATCTTGTGTTGTGCTTTGATAGAGGGGGCAGTCGAGGAAGATGAATTGGGCATTTTTTAGTGTCCACTCTCTTAGTGCTGCATTTTCAGCTTTGTCGAGAAACTCTTTATAGCTGGCCCCCTCTCCGGGATTGCAAAGCACTATTGATGGGATTCCACCTTTAATTTGAACCGGCTTTCCATATTTACAGTTGGACTGCCAGTCCCTTTGGGCCCCAATCAATTCTTTCCAGTGCTTTAGCTTTAAATAATGCGGAGCGACGTCATCAATGACGTTATACTTGACGTCATTTGAGAAAACCCTAGAATTGAAATCAAGGTGTCCACTCAAATAGTTATGTGGGCCTAAAGACCGAGCCCACATTGTTTTGCCCGTTCGAGAATCACCCTCAATTATTACACTAATAGGTCTATTACACACGTTATTTGATTCTTTTATTAAAAATGGCCGCGCAGCTGAACATTCATTAAAATAATGATCAGCCCAATCTTTTAACTCTTCTGGAACATTTGTAAACGAAGAAAGTTCATATGGGGGAACCCATGGCATTGGAGGTTTATGAAATAGGCGATCGACGTTAGCCGTTATGTTATGGTAACTCACTATAAACGTCTTTGGATCGCCAGCTTTTATAATGTCGAGAGCCTCTCCCGCACTTGCTGCATTGACGGCGTTGTGATAAACGTCGTCTTTATTGGACTTTGAACCCCCAGACACCTTATATTGCCCGAATTCACAATAATCACCTTCTTTGGTGATGTAATTCTTGACGGCATTGGTGTCTTTGGCAGCTTGAATATTAGGGTGAAATCGGGCAGACCTTCTTGGGTGAGTAATGTCGAAAAATCCAGCATCCTTGATGTTTGACTTGCCTGAAAGTTGAACGAGGCAGTGTAAGTGCGGGAACCCATCTGCGTGTTCCTCTCGTGCGACACGGATATATGTCGGTTTGACGACTGACCAGGATAGACCTTGCAGTATTTCAAGAACTTCATCTTTGGGAACATCGCACTTCGGATATGTTAGGAAAATATTTCTGGCAGATAAGCGGAACGATTTAGGGTTCTGTGGCATATTTTGTAAATATGAGCCGGGACACCAGGAGGAGCTCTCTCTAAAACCTATATTTGTGGTGTCCTGGTGTCCTATATATACTACAAGGCTTCTAGGAGGCTTCTAGGACACCAGGGGTAAATTCGGCCATCCGCAATAATATT

Gene Information

NCBI Accession YP_009175072.1
Location 530-1300
Gene Name BV1
Protein Name nuclear shuttle protein
Coding Region ATGTATTCGGCGAACTATAGACGTACTCGTGGGACTACCCAACGTGGTTCATATTCACGACGTCCAATATTCAAGCGTCCACATTATTTGTCTCGGTCAGATGATAAGCGTCGCACTAATTCGACTATTGTGCCTCATGCCGACACTAAGATGTTAAAACAACGGTTGCATGAGGATCAATTTGGCCCAGATTATGTTTTGTGTCATAATAGTGCGATGTCCACGTTTATTACTCTTCCTAGTCTTGGTAAGCACGAGCCCAATCGTTCAAGGTCGTTTATAAAGTTACAACGACTCCGTTACAAGGGAACTCTGAAAATTGAACGTGGACCTGGTGACACGTTCATGGAAGGTCCCACGTCAAAGGTAGAAGGCGTCTTTTCTATGGTAGTTGTGGTTGATCGTAAACCACATGTTAACCCATCTGGACGCTTACATTCCTTTGATGAGTTATTCGGCGCGCGTATCCATAGTCACGGTAATTTAGCCATAGTCCCGGCATTGAAGGAGCGTTTTTACATTCGCCACGTATTGAAACGAGTATTATCCGTCGAGAAAGACACGTTGATGGTTGATCTACATGGAACAACCGCATTATCTAATAGGCGATTCAATTGTTGGTCCTCGTTTAATGATCTTGAACGCGATTCATGTAACGGCGTTTACGCTAATATAAACAAGAACGCTCTTTTAGTTTATTATTGTTGGATGTCGGATATGCCTTCGAAGGCATCGACATATGTAACGTTTGATCTCGACTATGTCGGATAA
Protein Sequence MYSANYRRTRGTTQRGSYSRRPIFKRPHYLSRSDDKRRTNSTIVPHADTKMLKQRLHEDQFGPDYVLCHNSAMSTFITLPSLGKHEPNRSRSFIKLQRLRYKGTLKIERGPGDTFMEGPTSKVEGVFSMVVVVDRKPHVNPSGRLHSFDELFGARIHSHGNLAIVPALKERFYIRHVLKRVLSVEKDTLMVDLHGTTALSNRRFNCWSSFNDLERDSCNGVYANINKNALLVYYCWMSDMPSKASTYVTFDLDYVG

NCBI Accession YP_009175073.1
Location 1505-2386
Gene Name BC1
Protein Name movement protein
Coding Region ATGGGTTCTCAATTAGCTCCTCCACCGAATGCGTTCAATTATATAGAGTCTAGTCGGGATGAATTTCAGTTATCGCACGACTTAACGGAAATTATTCTGCAATTTCCGTCGACTACTTCCCAATTAACTGCAAGACTTAGTCGGAGTTGTATGAAGATCGACCATTGTGTCATAGAATATAGGCAACAAGTACCTATCAACGCATCTGGAACAGTAATAGTGGAGATTCACGATAAACGAATGACCGACAATGAGTCCTTACAAGCCTCGTGGACGTTTCCGATCAGATGTAACATAGATCTCCACTATTTCTCGTCATCATTCTTCTCTCTCAAAGATCCCATTCCTTGGAAGTTATATTATCGGGTAACAGACTCGAACGTGCATCAGATGACTCATTTCGCTAAATTCAAAGGTAAATTGAAGTTATCGTCGGCGAAACATTCCGTCGATATTCCCTTCCGGGCACCAACAGTCAAAATCCTTACAAAGCAATTTAGCCAAAAGGACGTCGATTTCTGGCACGTTGGGTACGGCAAATGGGAGAGAAGACTGGTCAAATCCGCATCGATGTCAAGATATGGGCTCAGAGGCCCAATTGAATTAAATCCAGGCGAATCTTGGGCCACTAGAAGTGCTCTGGGTACGAGCCCACTAAATGCGGACTTGGATACAACAGATGAGATGCTTCCCTATCGCGAGCTTAACAGGTTGGGTACATCTATATTAGACCCTGGAGAATCGGCGTCAATGGTCGGAATACAACGGTCGCAATCAAACATTACCATGTCAATGGCACAACTGAACGAATTAGTTAGATCCACCGTTCAGGAGTGCATCAAGACCAGTTGTATTCCCTCAACTCCAAAATCCTTAGGATAA
Protein Sequence MGSQLAPPPNAFNYIESSRDEFQLSHDLTEIILQFPSTTSQLTARLSRSCMKIDHCVIEYRQQVPINASGTVIVEIHDKRMTDNESLQASWTFPIRCNIDLHYFSSSFFSLKDPIPWKLYYRVTDSNVHQMTHFAKFKGKLKLSSAKHSVDIPFRAPTVKILTKQFSQKDVDFWHVGYGKWERRLVKSASMSRYGLRGPIELNPGESWATRSALGTSPLNADLDTTDEMLPYRELNRLGTSILDPGESASMVGIQRSQSNITMSMAQLNELVRSTVQECIKTSCIPSTPKSLG

NCBI Accession NP_835272.1
Location 206-961
Gene Name AV1
Protein Name coat protein
Coding Region ATGGTTAAGAGGGATGCCCCATGGCGTTTAATGGCGGGGACCTCCAAGGTTTCCCGCTCTGCTAATTATTCGCCTCGTGGAGGTATGGGCCCTAAATTCAATAAGGCCGCTGCATGGGTTAATAGGCCCATGTACAGGAAGCCCAGAATTTATCGCACGTTACGAGGTCCTGACATCCCCAAAGGATGTGAAGGACCATGCAAGGTTCAATCATTTGAGCAGCGGCATGATATCTCTCATATTGGTAAGGTTATGTGTATTTCTGACGTGACGCGTGGCAATGGTATTACTCACCGCGTCGGCAAGCGTTTTTGTGTTAAGTCTGTATATATTTTAGGCAAGATATGGATGGACGAAAACATCAAGCTGAAGAATCACACAAACAGTGTGATGTTTTGGCTAGTTCGAGATCGGAGACCCTATGGCACTCCTATGGATTTCGGCCAAGTATTCAACATGTTTGACAACGAGCCTAGCACTGCAACCGTTAAGAACGATCTACGAGATCGTTATCAAGTTTTGCACAGGTTTTACGCGAAAGTCACTGGTGGTCAGTATGCTAGCAACGAACAAGCCTTGGTGAGGCGTTTTTGGAAGGTCAACAATTATGTTGTCTACAATCACCAGGAAGCAGCAAAATACGAGAATCATACGGAGAACGCTTTATTATTGTATATGGCATGTACTCATGCATCTAACCCTGTGTACGCGACATTGAAAATTCGGATCTATTTTTATGATTCGATAACAAATTAA
Protein Sequence MVKRDAPWRLMAGTSKVSRSANYSPRGGMGPKFNKAAAWVNRPMYRKPRIYRTLRGPDIPKGCEGPCKVQSFEQRHDISHIGKVMCISDVTRGNGITHRVGKRFCVKSVYILGKIWMDENIKLKNHTNSVMFWLVRDRRPYGTPMDFGQVFNMFDNEPSTATVKNDLRDRYQVLHRFYAKVTGGQYASNEQALVRRFWKVNNYVVYNHQEAAKYENHTENALLLYMACTHASNPVYATLKIRIYFYDSITN

NCBI Accession NP_835273.1
Location 958-1362
Gene Name AC3
Protein Name replicase-associated protein
Coding Region ATGGTAATGGATTTACGCACTTGGGAAGACATCACTGTGTATCAGGCGGAGAATTCCGTTTTTATCTGGGAAGTTCCAAATCCCCTCTATTTCAAGATATACAAAGTGGAGGATCCACTGTATACGCACACAAGAATATACCACATACAAATCCGATTCAACCACAACCTGCGGAGAGCGCTAAATCTTCACAAAGCATACCTGAACTTCCAAGTCTGGACGGAATCGATTCGAGCTTCTGGGACGACTTATTTAAATAGATTTAAACATTTAGTTATGTTGTATTTAGATAGATTAGGGGTTATCGGTCTCAATAACGTCATACGTGCTGTATCATGGGCGACAGACCGTTCATATGTAAATTATGTAATCGAGAATCATATAATAAAATTCAACGTTTATTAA
Protein Sequence MVMDLRTWEDITVYQAENSVFIWEVPNPLYFKIYKVEDPLYTHTRIYHIQIRFNHNLRRALNLHKAYLNFQVWTESIRASGTTYLNRFKHLVMLYLDRLGVIGLNNVIRAVSWATDRSYVNYVIENHIIKFNVY

NCBI Accession NP_835274.1
Location 1103-1498
Gene Name AC2
Protein Name transactivation protein
Coding Region ATGCCCAATTCATCTTCCTCGACTGCCCCCTCTATCAAAGCACAACACAAGATCGCTAAAACAAGAGCTATCCGTCGTAGACGCATCGACCTGAACTGCGGCTGTTCCATATTCCTCCATCTTAGCTGCCAAAAAAATGGTAATGGATTTACGCACTTGGGAAGACATCACTGTGTATCAGGCGGAGAATTCCGTTTTTATCTGGGAAGTTCCAAATCCCCTCTATTTCAAGATATACAAAGTGGAGGATCCACTGTATACGCACACAAGAATATACCACATACAAATCCGATTCAACCACAACCTGCGGAGAGCGCTAAATCTTCACAAAGCATACCTGAACTTCCAAGTCTGGACGGAATCGATTCGAGCTTCTGGGACGACTTATTTAAATAG
Protein Sequence MPNSSSSTAPSIKAQHKIAKTRAIRRRRIDLNCGCSIFLHLSCQKNGNGFTHLGRHHCVSGGEFRFYLGSSKSPLFQDIQSGGSTVYAHKNIPHTNPIQPQPAESAKSSQSIPELPSLDGIDSSFWDDLFK

NCBI Accession NP_835275.1
Location 1440-2519
Gene Name AC1
Protein Name replication-associated protein
Coding Region ATGCCACAGAACCCTAAATCGTTCCGCTTATCTGCCAGAAATATTTTCCTAACATATCCGAAGTGCGATGTTCCCAAAGATGAAGTTCTTGAAATACTGCAAGGTCTATCCTGGTCAGTCGTCAAACCGACATATATCCGTGTCGCACGAGAGGAACACGCAGATGGGTTCCCGCACTTACACTGCCTCGTTCAACTTTCAGGCAAGTCAAACATCAAGGATGCTGGATTTTTCGACATTACTCACCCAAGAAGGTCTGCCCGATTTCACCCTAATATTCAAGCTGCCAAAGACACCAATGCCGTCAAGAATTACATCACCAAAGAAGGTGATTATTGTGAATTCGGGCAATATAAGGTGTCTGGGGGTTCAAAGTCCAATAAAGACGACGTTTATCACAACGCCGTCAATGCAGCAAGTGCGGGAGAGGCTCTCGACATTATAAAAGCTGGCGATCCAAAGACGTTTATAGTGAGTTACCATAACATAACGGCTAACGTCGATCGCCTATTTCATAAACCTCCAATGCCATGGGTTCCCCCATATGAACTTTCTTCGTTTACAAATGTTCCAGAAGAGTTAAAAGATTGGGCTGATCATTATTTTAATGAATGTTCAGCTGCGCGGCCATTTTTAATAAAAGAATCAAATAACGTGTGTAATAGACCTATTAGTGTAATAATTGAGGGTGATTCTCGAACGGGCAAAACAATGTGGGCTCGGTCTTTAGGCCCACATAACTATTTGAGTGGACACCTTGATTTCAATTCTAGGGTTTTCTCAAATGACGTCAAGTATAACGTCATTGATGACGTCGCTCCGCATTATTTAAAGCTAAAGCACTGGAAAGAATTGATTGGGGCCCAAAGGGACTGGCAGTCCAACTGTAAATATGGAAAGCCGGTTCAAATTAAAGGTGGAATCCCATCAATAGTGCTTTGCAATCCCGGAGAGGGGGCCAGCTATAAAGAGTTTCTCGACAAAGCTGAAAATGCAGCACTAAGAGAGTGGACACTAAAAAATGCCCAATTCATCTTCCTCGACTGCCCCCTCTATCAAAGCACAACACAAGATCGCTAA
Protein Sequence MPQNPKSFRLSARNIFLTYPKCDVPKDEVLEILQGLSWSVVKPTYIRVAREEHADGFPHLHCLVQLSGKSNIKDAGFFDITHPRRSARFHPNIQAAKDTNAVKNYITKEGDYCEFGQYKVSGGSKSNKDDVYHNAVNAASAGEALDIIKAGDPKTFIVSYHNITANVDRLFHKPPMPWVPPYELSSFTNVPEELKDWADHYFNECSAARPFLIKESNNVCNRPISVIIEGDSRTGKTMWARSLGPHNYLSGHLDFNSRVFSNDVKYNVIDDVAPHYLKLKHWKELIGAQRDWQSNCKYGKPVQIKGGIPSIVLCNPGEGASYKEFLDKAENAALREWTLKNAQFIFLDCPLYQSTTQDR

References More References in PubMed

1

The Begomovirus Species Melon Chlorotic Leaf Curl Virus is Composed of Two Highly Divergent Strains that Differ in Their Genetic and Biological Properties.

Maliano MR, et al.  Plant Dis. 2021 Oct;105(10):3162-3170. doi: 10.1094/PDIS-08-20-1759-RE. Epub 2021 Nov 7.

PMID: 33591835

2

Resistance Against Melon Chlorotic Mosaic Virus and Tomato Leaf Curl New Delhi Virus in Melon.

Romay G, et al.  Plant Dis. 2019 Nov;103(11):2913-2919. doi: 10.1094/PDIS-02-19-0298-RE. Epub 2019 Aug 20.

PMID: 31436474

3

Melon chlorotic leaf curl virus, a New Begomovirus Associated with Bemisia tabaci Infestations in Guatemala.

Brown JK, et al.  Plant Dis. 2001 Sep;85(9):1027. doi: 10.1094/PDIS.2001.85.9.1027C.

PMID: 30823088

4

Analysis of watermelon chlorotic stunt virus and tomato leaf curl Palampur virus mixed and pseudo-recombination infections.

Esmaeili M, et al.  Virus Genes. 2015 Dec;51(3):408-16. doi: 10.1007/s11262-015-1250-5. Epub 2015 Oct 3.

PMID: 26433951

5

Occurrence of Tomato Leaf Curl New Delhi Virus in Cucurbit Plants in China.

Zeng R, et al.  Plant Dis. 2023 Mar 22. doi: 10.1094/PDIS-01-23-0059-PDN. Online ahead of print.

PMID: 36947833

6

Identification of the Begomoviruses Squash Leaf Curl Virus and Watermelon Chlorotic Stunt Virus in Various Plant Samples in North America.

Fontenele RS, et al.  Viruses. 2021 Apr 30;13(5):810. doi: 10.3390/v13050810.

PMID: 33946382

7

Sida chlorotic leaf virus: a new recombinant begomovirus found in non-cultivated plants and Cucumis sativus L.

García-Rodríguez DA, et al.  PeerJ. 2023 Mar 22;11:e15047. doi: 10.7717/peerj.15047. eCollection 2023.

PMID: 36974135

8

First report of tomato leaf curl New Delhi virus infecting several cucurbit plants in China.

Gu Q, et al.  Plant Dis. 2023 Apr 20. doi: 10.1094/PDIS-01-23-0180-PDN. Online ahead of print.

PMID: 37081636

9

First report of cucurbit yellow stunting disorder virus and cucurbit chlorotic yellows virus in melon in the Central Valley of California.

Mondal S, et al.  Plant Dis. 2021 May 19. doi: 10.1094/PDIS-01-21-0184-PDN. Online ahead of print.

PMID: 34010021

10

Melon chlorotic leaf curl virus: characterization and differential reassortment with closest relatives reveal adaptive virulence in the squash leaf curl virus clade and host shifting by the host-restricted bean calico mosaic virus.

Idris AM, et al.  J Virol. 2008 Feb;82(4):1959-67. doi: 10.1128/JVI.01992-07. Epub 2007 Dec 5.

PMID: 18057231