Euphorbia mosaic virus


Basic Information

Genus Begomovirus
NCBI Assembly GCF_000869345.1
Isolate Mexico: Yucatan
Release date 2015/2/13
Submitter Hernandez-Zepeda,C., Idris,A.M., Carnevali,G., Brown,J.K., Moreno-Valenzuela,O.A.
Host
Vector
Download Genome |GFF3 |PEP |CDS

Genomic Organization


JBrowse


Genome

NC_008304
ACCGGATGGCCGCGATTTTTTTGGTGTCCTCTTAGCCCGGCCCAGGCCCAACCGCAAAGCTATTCTCGTCCTTTTATGGGACCACTACAATTATTTTTGACCAATCATAGTGCGCCTGACAAGCCTATATAATTATGACTTACCCACCAAGCTGTGGTCCCTATAAATAAAGATGATTAACCCCATACCTCTTTAATTCAAAATGGTTAAGAGGGATGCCCCATGGCGACTATCGGCGGGGACCTTTAAGGTTTCCCGCTCTTCTAACTATTCGCCTCGTGGAGGTATGGGCCCTAAATTGGATAAGGCCGCTGCGTGGGTTAATAGGCCCATGTACAGAAAGCCCAGGATCTATCGGACGCTGAGAGGGCCCGACGTTCCCAAAGGCTGTGAAGGGCCCTGCAAGGTTCAGTCTTACGAGCAGCGGCACGACATTTCTCACGTTGGTAAGGTGATTTGCATATCTGACGTGACCCGTGGTAACGGTATAACACATCGTGTAGGCAAACGTTTCTGCGTCAAGTCTGTATATATTTTAGGGAAGATATGGATGGACGAGAATATCAAGTTGAAGAACCACACCAACAGCGTCATGTTTTGGCTGGTTAGAGATCGTAGACCGTATGGAACGCCTATGGATTTTGGTCAAGTGTTCAACATGTTCGATAACGAGCCCAGTACAGCTACGGTCAAGAACGATCTCCGCGATCGCTACCAGGTGATGCACAAGTTTTACGCGAAGGTTACCGGTGGACAATACGCGAGCAACGAGCAGGCGTTGGTGAAGAGATTCTGGAAGGTCAACAACCATGTGGTGTACAACCATCAGGAAGCAGGGAAATATGAGAATCATACGGAGAACGCGTTGTTATTGTATATGGCATGTACTCATGCATCTAACCCCGTGTATGCGACATTGAAAATTCGGATCTATTTTTATGATTCGATAATGAATTAATAAATATTAAACTTTATTTCATGATCTTCGAGTACATAATTTACATATGAACGGTCTGTTGCGAAACGCACAGCTCTAATGACATTATTAATTCCAATCACACCAAGCCGATCTAAATACAACATAACTAAATGCCTAAAGCGACTTAAATAGCTCGTCCCAGAAGCTCGAACTGATGTCGTCCAGACTTGGAAGTTCAGGTAGGCTTGGTGTAGATTCAACGCCTTCCTGAGGTTGTAGTTGAACCGGATTTGGACGTGGTATACTCTGACCCACGTATGAACTGGATCCTCTACTCTGATTATCTTGAAATAGAGGGGATTTGGAACCTCCCAGATAAAAACGGAATTCTCTGCCTGAGACGCAGTGATGTTCTCCCCGGTGCGTGAATCCATTATCCGCGCAGTTGATGTGGAGGAATATGGAACAGCCGCAGTTCAAGTCAATCCGTCGTCGACGTATGGCTCTCTTCTTGGCAATCCTGTGCTGTGGTTTGATAGAGGGGGGAGTTGAGGAAGATGAATTTAGCATTTTTTAATGTCCAGGCTCTCAGTGGTGCATTTTCCTCTTTCTCGAGGAAATCTTTATATGACCCCCCCTCTCCTGGATTGCACAGCACGATTGATGGGATACCTCCTTTAATTTGAACCGGCTTTCCATATTTACAGTTGGACTGCCAGTCCTTTTGGGCCCCAATCAATTCCTTCCAGTGCTTTAGCTTTAAGTATTGCGGATTGACATCATCTATGACGTTATACTCCACTTGATTGGAGTATACCCTAGAATTGAAATCAAGATGACCGCTCAGATAATTATGTGGGCCTAAAGCACGAGCCCACATTGTCTTGCCCGTTCGTGAATCCCCTTCGACTATCAAACTAATCGGTCTCTCTGGCCGCGCAGCGGCACCCCTCCCAAAATAATCATCCGCCCACTCTTGCATCTCTTCTGGCACATTGACGAACGACGAAAGACTAAAAGGAGGGGTCCACGGTTCTGGGGCCTTACGAAAGAGGCGATCGATGTTAGCTTTCAAATTATGATAACTAACGATAAACGTTTTAGGATCGCCAGCTTTTATAATGTCGAGAGCCTCTCCCGCACTTGCTGCATTGACGGCGTTGTGATATACGTCGTCTTTATTGGACTTTGTACCCCCAGACACTCTATATTGCCCGGATTCACAATAATCACCTTCTTTGGTGATGTAATTCTTGACGGCGTTGGCGTCCTTGGCTGCTTGCACATTTGGGTGAAAACGGGCAGACCGTCTGGGGTGAGATAGGTCGAAAAATCTAGCATCCTTGATGTTGGACTTGCCGGATAATTGTATGAGGCAGTGTAAGTGCGGGAACCCATCGCGATGTTCCTCTCTAGCGACTCGGATGTACGTCGGTTTGACGACTGACCAAGGCAGATGTTGAAGCATCTGAAGAACTTCATCTTTGGGAACATCGCACTGAGGATATGTTAAGAAAATGCTTTTGGCAGCAAGACGAAATGAATTAGGGTTCCGTGGCATTTTTGTAAATATAAGCCAGGACACCAGGGTGACTCTCTCATAAAACCTATTATTGCTGGTGTCCTGGTGTCCCATTTATACTAAAAGTCTCTGGGGGACACTAGGGGCAAAAGCGGCCATCCGCAATAATATT

NC_008305
ACCGGATGGCCGCGATTTTTTTGGTGTCCCCGTTCTCGGCCCAGGCCCAACCGCATTTTACACACTCAAAACGCTCCGTTTTGTCATCTATTTATGCGGGACCACCGAATAGATGTCAGGACCACTTGCAAAATGACAATTATTTTTGACCAATCACGTCTCGCGTGAGTAGCCTACATAATAACGACTTATCCGCCAAGTCGTTGCCCTATTTACTGAAGGGTATCTGGAATTGTCATTTTCTTCTTTAATTCAAATTTGGGAGCGGGAACGGTCATGGTGTTTAACGACGTGATTGCACTAGCGTTGTGGTCCTAGCCACAATCCACAACAACTTAACATATCCTCAGTGCGATGTTCCCAAAGATGAAGTTCTTCAGATGCTGCGATCCAATGAAATTTCAGCTACAAAGTCTAGTTATCGAACATGTTGAGTCCAGATCTGTTTAAATATAGTATTGGTTTCATTGGATCTCACGTCTATACATTCAGTTCCTGGTCATCTTACATCATCTAGCTACAATAGTTGATATGTATTCTACTAAGTATAGACGTGGTGGGTCGACTTCTCATCGTCGATTTAATTCACGTAATACATTGTTTAAGCGTCAGCATCCTAGCAGGCGTGTTGATTATAGACGTCGACCCAGCAGCCCTAACAAGGCCCACGACGACTCGACGATGATTAATCAACGTATTCACGAAGACCAGTTTGGGCCCGAATTTGTATTGGCCCATAATATGGCCTTGTCCTCGTACATTAGCTTCCCCAGTCTCACGAGGACTGAACCCAATAGGTCTAGGTCATACATCAAGTTACGACGACTACGTTATAAGGGCACGCTCAAGATTGAACGTGTTCAGTCCGACATGAACCTTGATGGGTCAAGCCCTAAGATCGAAGGAGTATTCACTATGGTCGTTGTGGTCGATCGTAAACCTCATTTGAACCCAACTGGATGTCTACATACGTTTGACGATTTATTTGGAGCGAGGATCCATAGTCACGGCAATTTGACAATCACTCCTTCGCTGAAAGATCGATTTTATATACGTCATGTGATGAAACGTGTATTGTCTGTCGAGAAGGACTCGTTGATGGTCGATCTTGAAGGATCTACGGCGTTATCTAACAAACGTGTTAACTGCTGGGCAGCATTTAGGGATCTCGATAGAGACTCATGTAACGGCGTATATGCCAATATTAGCAAGAACGCCTTATTAGTTTATTACTGCTGGATGTCCGATGCTATGTCTAAGGCATCAACGTTTGTATCATTTGATTTGGATTATTTCGGATAAATAATAACATATATTTCTGCATAGGTGCTCGGTTTGAGTTCTTACCCAACAATCATATCTCATAACATAAATTATTACATAATTTATTTATTGCAACGATTTCGTATGTGAGGGGAGACAGTTTGTGTTGATACACTCCTGGACCGTCGACCTGACTATCTCATTAATCTGGGCTACAGACAACGTTATATTTGATTGGGCCCTATGGGCTGCGACGACAGATGCGGAATCACCTGGGTCCAGGACTGGTGTACTCAACCGGTTTAGCTCTCTGTATGGATGAATCTCGTCCGAATCCGCATTCGAATGGACCGGGCCTATAGTACTCCTACTAGCCCAGGACTCTCCTGGATTAATAGCAATTGGGCCTGGAAGGCCATATCTGGAGGATGCGGATTTTATCATTCTTCTCTCCCACTTGCCGTATCCCACATGACTGAAATCTATATCCTTATCGGTAAACTGTTTTGACAATATCTTGACCGTCGGAGCCCGGAAGGGTATATCAACTGAATGTTTAGCAGTCGACAATTTCAGTTTACCCTTGAATTTTGCGAAGTGTGTCATTTGATGTACGTTCGTATCGCAAACTTTGTAATATAGTTTCCAAGGAACCGGGTCTTTGAGAGAGAAGAATGAAGATGAAAAGTAGTGGAGATCTATGTTGCATCTTATCGGGAAAGTCCACGACGCCTGTAACGACTCATCGTCAGTCATTCTCTTGTCGTGAATCTCCACTACCACCGTACCGGAGGCGTTGATAGGTACTTGTTGTCTATATTCTATCACGCAGTGGTCGATCTTCATACAGCTGCGACTCAGCCTCGCACTCAGTTGAGACGCCGTAGACGGAAATTGCAATACTATCTCAGTTAGGTCATGAGATAGCTGATACTCATCACGACGAGATTCGATATAATTAAAAACGTTTGGGGGTGTTACTAATTGTGAATCCATGGCCGCGCAGCGGAATTGCTCAACAATTCTGAGAGAGGAAGATAATGACTATCTATGACGGAAGTCGATCGGAGGAAATGCTAAGACTAAGGAAGAGCTAATATTAAGGTTAATGCCCGATTAAAGAAGGGCTATTGGAATAGATGTTGATGACGGAGTCGATAAATAACCTTCCTTATATAGACGTAATGCCTAGTAGTCAGTGGCATTTTTGTAATTATGACCCAGGACACCAGGGAGGCTCTCTCATAAAACCTATTATTGCTGGTGTCCTGGTGTCCCATTTATACTAGAAGTCTCTAGGACACCAAGGGGGCACGTGGCGGCCATCCGCAATAATATT

Gene Information

NCBI Accession YP_717927.1
Location 203-958
Gene Name AV1
Protein Name coat protein
Coding Region ATGGTTAAGAGGGATGCCCCATGGCGACTATCGGCGGGGACCTTTAAGGTTTCCCGCTCTTCTAACTATTCGCCTCGTGGAGGTATGGGCCCTAAATTGGATAAGGCCGCTGCGTGGGTTAATAGGCCCATGTACAGAAAGCCCAGGATCTATCGGACGCTGAGAGGGCCCGACGTTCCCAAAGGCTGTGAAGGGCCCTGCAAGGTTCAGTCTTACGAGCAGCGGCACGACATTTCTCACGTTGGTAAGGTGATTTGCATATCTGACGTGACCCGTGGTAACGGTATAACACATCGTGTAGGCAAACGTTTCTGCGTCAAGTCTGTATATATTTTAGGGAAGATATGGATGGACGAGAATATCAAGTTGAAGAACCACACCAACAGCGTCATGTTTTGGCTGGTTAGAGATCGTAGACCGTATGGAACGCCTATGGATTTTGGTCAAGTGTTCAACATGTTCGATAACGAGCCCAGTACAGCTACGGTCAAGAACGATCTCCGCGATCGCTACCAGGTGATGCACAAGTTTTACGCGAAGGTTACCGGTGGACAATACGCGAGCAACGAGCAGGCGTTGGTGAAGAGATTCTGGAAGGTCAACAACCATGTGGTGTACAACCATCAGGAAGCAGGGAAATATGAGAATCATACGGAGAACGCGTTGTTATTGTATATGGCATGTACTCATGCATCTAACCCCGTGTATGCGACATTGAAAATTCGGATCTATTTTTATGATTCGATAATGAATTAA
Protein Sequence MVKRDAPWRLSAGTFKVSRSSNYSPRGGMGPKLDKAAAWVNRPMYRKPRIYRTLRGPDVPKGCEGPCKVQSYEQRHDISHVGKVICISDVTRGNGITHRVGKRFCVKSVYILGKIWMDENIKLKNHTNSVMFWLVRDRRPYGTPMDFGQVFNMFDNEPSTATVKNDLRDRYQVMHKFYAKVTGGQYASNEQALVKRFWKVNNHVVYNHQEAGKYENHTENALLLYMACTHASNPVYATLKIRIYFYDSIMN

NCBI Accession YP_717928.1
Location 955-1353
Gene Name AC3
Protein Name replication enhancer protein REn
Coding Region ATGGATTCACGCACCGGGGAGAACATCACTGCGTCTCAGGCAGAGAATTCCGTTTTTATCTGGGAGGTTCCAAATCCCCTCTATTTCAAGATAATCAGAGTAGAGGATCCAGTTCATACGTGGGTCAGAGTATACCACGTCCAAATCCGGTTCAACTACAACCTCAGGAAGGCGTTGAATCTACACCAAGCCTACCTGAACTTCCAAGTCTGGACGACATCAGTTCGAGCTTCTGGGACGAGCTATTTAAGTCGCTTTAGGCATTTAGTTATGTTGTATTTAGATCGGCTTGGTGTGATTGGAATTAATAATGTCATTAGAGCTGTGCGTTTCGCAACAGACCGTTCATATGTAAATTATGTACTCGAAGATCATGAAATAAAGTTTAATATTTATTAA
Protein Sequence MDSRTGENITASQAENSVFIWEVPNPLYFKIIRVEDPVHTWVRVYHVQIRFNYNLRKALNLHQAYLNFQVWTTSVRASGTSYLSRFRHLVMLYLDRLGVIGINNVIRAVRFATDRSYVNYVLEDHEIKFNIY

NCBI Accession YP_717929.1
Location 1094-1489
Gene Name AC2
Protein Name TrAP transactivator protein
Coding Region ATGCTAAATTCATCTTCCTCAACTCCCCCCTCTATCAAACCACAGCACAGGATTGCCAAGAAGAGAGCCATACGTCGACGACGGATTGACTTGAACTGCGGCTGTTCCATATTCCTCCACATCAACTGCGCGGATAATGGATTCACGCACCGGGGAGAACATCACTGCGTCTCAGGCAGAGAATTCCGTTTTTATCTGGGAGGTTCCAAATCCCCTCTATTTCAAGATAATCAGAGTAGAGGATCCAGTTCATACGTGGGTCAGAGTATACCACGTCCAAATCCGGTTCAACTACAACCTCAGGAAGGCGTTGAATCTACACCAAGCCTACCTGAACTTCCAAGTCTGGACGACATCAGTTCGAGCTTCTGGGACGAGCTATTTAAGTCGCTTTAG
Protein Sequence MLNSSSSTPPSIKPQHRIAKKRAIRRRRIDLNCGCSIFLHINCADNGFTHRGEHHCVSGREFRFYLGGSKSPLFQDNQSRGSSSYVGQSIPRPNPVQLQPQEGVESTPSLPELPSLDDISSSFWDELFKSL

NCBI Accession YP_717930.1
Location 1401-2555
Gene Name AC1
Protein Name rep protein
Coding Region ATGGGACACCAGGACACCAGCAATAATAGGTTTTATGAGAGAGTCACCCTGGTGTCCTGGCTTATATTTACAAAAATGCCACGGAACCCTAATTCATTTCGTCTTGCTGCCAAAAGCATTTTCTTAACATATCCTCAGTGCGATGTTCCCAAAGATGAAGTTCTTCAGATGCTTCAACATCTGCCTTGGTCAGTCGTCAAACCGACGTACATCCGAGTCGCTAGAGAGGAACATCGCGATGGGTTCCCGCACTTACACTGCCTCATACAATTATCCGGCAAGTCCAACATCAAGGATGCTAGATTTTTCGACCTATCTCACCCCAGACGGTCTGCCCGTTTTCACCCAAATGTGCAAGCAGCCAAGGACGCCAACGCCGTCAAGAATTACATCACCAAAGAAGGTGATTATTGTGAATCCGGGCAATATAGAGTGTCTGGGGGTACAAAGTCCAATAAAGACGACGTATATCACAACGCCGTCAATGCAGCAAGTGCGGGAGAGGCTCTCGACATTATAAAAGCTGGCGATCCTAAAACGTTTATCGTTAGTTATCATAATTTGAAAGCTAACATCGATCGCCTCTTTCGTAAGGCCCCAGAACCGTGGACCCCTCCTTTTAGTCTTTCGTCGTTCGTCAATGTGCCAGAAGAGATGCAAGAGTGGGCGGATGATTATTTTGGGAGGGGTGCCGCTGCGCGGCCAGAGAGACCGATTAGTTTGATAGTCGAAGGGGATTCACGAACGGGCAAGACAATGTGGGCTCGTGCTTTAGGCCCACATAATTATCTGAGCGGTCATCTTGATTTCAATTCTAGGGTATACTCCAATCAAGTGGAGTATAACGTCATAGATGATGTCAATCCGCAATACTTAAAGCTAAAGCACTGGAAGGAATTGATTGGGGCCCAAAAGGACTGGCAGTCCAACTGTAAATATGGAAAGCCGGTTCAAATTAAAGGAGGTATCCCATCAATCGTGCTGTGCAATCCAGGAGAGGGGGGGTCATATAAAGATTTCCTCGAGAAAGAGGAAAATGCACCACTGAGAGCCTGGACATTAAAAAATGCTAAATTCATCTTCCTCAACTCCCCCCTCTATCAAACCACAGCACAGGATTGCCAAGAAGAGAGCCATACGTCGACGACGGATTGA
Protein Sequence MGHQDTSNNRFYERVTLVSWLIFTKMPRNPNSFRLAAKSIFLTYPQCDVPKDEVLQMLQHLPWSVVKPTYIRVAREEHRDGFPHLHCLIQLSGKSNIKDARFFDLSHPRRSARFHPNVQAAKDANAVKNYITKEGDYCESGQYRVSGGTKSNKDDVYHNAVNAASAGEALDIIKAGDPKTFIVSYHNLKANIDRLFRKAPEPWTPPFSLSSFVNVPEEMQEWADDYFGRGAAARPERPISLIVEGDSRTGKTMWARALGPHNYLSGHLDFNSRVYSNQVEYNVIDDVNPQYLKLKHWKELIGAQKDWQSNCKYGKPVQIKGGIPSIVLCNPGEGGSYKDFLEKEENAPLRAWTLKNAKFIFLNSPLYQTTAQDCQEESHTSTTD

NCBI Accession YP_717931.1
Location 532-1302
Gene Name BV1
Protein Name nuclear shuttle protein
Coding Region ATGTATTCTACTAAGTATAGACGTGGTGGGTCGACTTCTCATCGTCGATTTAATTCACGTAATACATTGTTTAAGCGTCAGCATCCTAGCAGGCGTGTTGATTATAGACGTCGACCCAGCAGCCCTAACAAGGCCCACGACGACTCGACGATGATTAATCAACGTATTCACGAAGACCAGTTTGGGCCCGAATTTGTATTGGCCCATAATATGGCCTTGTCCTCGTACATTAGCTTCCCCAGTCTCACGAGGACTGAACCCAATAGGTCTAGGTCATACATCAAGTTACGACGACTACGTTATAAGGGCACGCTCAAGATTGAACGTGTTCAGTCCGACATGAACCTTGATGGGTCAAGCCCTAAGATCGAAGGAGTATTCACTATGGTCGTTGTGGTCGATCGTAAACCTCATTTGAACCCAACTGGATGTCTACATACGTTTGACGATTTATTTGGAGCGAGGATCCATAGTCACGGCAATTTGACAATCACTCCTTCGCTGAAAGATCGATTTTATATACGTCATGTGATGAAACGTGTATTGTCTGTCGAGAAGGACTCGTTGATGGTCGATCTTGAAGGATCTACGGCGTTATCTAACAAACGTGTTAACTGCTGGGCAGCATTTAGGGATCTCGATAGAGACTCATGTAACGGCGTATATGCCAATATTAGCAAGAACGCCTTATTAGTTTATTACTGCTGGATGTCCGATGCTATGTCTAAGGCATCAACGTTTGTATCATTTGATTTGGATTATTTCGGATAA
Protein Sequence MYSTKYRRGGSTSHRRFNSRNTLFKRQHPSRRVDYRRRPSSPNKAHDDSTMINQRIHEDQFGPEFVLAHNMALSSYISFPSLTRTEPNRSRSYIKLRRLRYKGTLKIERVQSDMNLDGSSPKIEGVFTMVVVVDRKPHLNPTGCLHTFDDLFGARIHSHGNLTITPSLKDRFYIRHVMKRVLSVEKDSLMVDLEGSTALSNKRVNCWAAFRDLDRDSCNGVYANISKNALLVYYCWMSDAMSKASTFVSFDLDYFG

NCBI Accession YP_717932.1
Location 1390-2109
Gene Name BC2
Protein Name movement protein
Coding Region ATGAAGATCGACCACTGCGTGATAGAATATAGACAACAAGTACCTATCAACGCCTCCGGTACGGTGGTAGTGGAGATTCACGACAAGAGAATGACTGACGATGAGTCGTTACAGGCGTCGTGGACTTTCCCGATAAGATGCAACATAGATCTCCACTACTTTTCATCTTCATTCTTCTCTCTCAAAGACCCGGTTCCTTGGAAACTATATTACAAAGTTTGCGATACGAACGTACATCAAATGACACACTTCGCAAAATTCAAGGGTAAACTGAAATTGTCGACTGCTAAACATTCAGTTGATATACCCTTCCGGGCTCCGACGGTCAAGATATTGTCAAAACAGTTTACCGATAAGGATATAGATTTCAGTCATGTGGGATACGGCAAGTGGGAGAGAAGAATGATAAAATCCGCATCCTCCAGATATGGCCTTCCAGGCCCAATTGCTATTAATCCAGGAGAGTCCTGGGCTAGTAGGAGTACTATAGGCCCGGTCCATTCGAATGCGGATTCGGACGAGATTCATCCATACAGAGAGCTAAACCGGTTGAGTACACCAGTCCTGGACCCAGGTGATTCCGCATCTGTCGTCGCAGCCCATAGGGCCCAATCAAATATAACGTTGTCTGTAGCCCAGATTAATGAGATAGTCAGGTCGACGGTCCAGGAGTGTATCAACACAAACTGTCTCCCCTCACATACGAAATCGTTGCAATAA
Protein Sequence MKIDHCVIEYRQQVPINASGTVVVEIHDKRMTDDESLQASWTFPIRCNIDLHYFSSSFFSLKDPVPWKLYYKVCDTNVHQMTHFAKFKGKLKLSTAKHSVDIPFRAPTVKILSKQFTDKDIDFSHVGYGKWERRMIKSASSRYGLPGPIAINPGESWASRSTIGPVHSNADSDEIHPYRELNRLSTPVLDPGDSASVVAAHRAQSNITLSVAQINEIVRSTVQECINTNCLPSHTKSLQ

References More References in PubMed

1

Genome Sequence of Euphorbia mosaic virus from Passionfruit and Euphorbia heterophylla in Florida.

Polston JE, et al.  Genome Announc. 2017 Mar 2;5(9):e01714-16. doi: 10.1128/genomeA.01714-16.

PMID: 28254981

2

Detection of Poinsettia mosaic virus Infecting Poinsettias (Euphorbia pulcherrima) in Venezuela.

Carballo O, et al.  Plant Dis. 2001 Nov;85(11):1208. doi: 10.1094/PDIS.2001.85.11.1208D.

PMID: 30823179

3

Natural Infection of Tomatoes (Solanum lycopersicum) by Euphorbia yellow mosaic virus Isolates across Four Brazilian States.

Duarte MF, et al.  Plant Dis. 2020 Sep 4. doi: 10.1094/PDIS-04-20-0768-PDN. Online ahead of print.

PMID: 32886042

4

Detection of Poinsettia mosaic virus by RT-PCR in Euphorbia spp. in New Zealand.

Lebas BSM, et al.  Plant Dis. 2007 Jan;91(1):110. doi: 10.1094/PD-91-0110A.

PMID: 30781078

5

Molecular and biological characterization of a new Brazilian begomovirus, euphorbia yellow mosaic virus (EuYMV), infecting Euphorbia heterophylla plants.

Fernandes FR, et al.  Arch Virol. 2011 Nov;156(11):2063-9. doi: 10.1007/s00705-011-1070-4. Epub 2011 Jul 22.

PMID: 21779908

6

Interaction between the New World begomovirus Euphorbia yellow mosaic virus and its associated alphasatellite: effects on infection and transmission by the whitefly Bemisia tabaci.

Mar TB, et al.  J Gen Virol. 2017 Jun;98(6):1552-1562. doi: 10.1099/jgv.0.000814. Epub 2017 Jun 8.

PMID: 28590236

7

Genetic variability and population structure of the New World begomovirus Euphorbia yellow mosaic virus.

Mar TB, et al.  J Gen Virol. 2017 Jun;98(6):1537-1551. doi: 10.1099/jgv.0.000784. Epub 2017 Jun 13.

PMID: 28612702

8

Agrobacterium tumefaciens-mediated transformation of poinsettia, Euphorbia pulcherrima, with virus-derived hairpin RNA constructs confers resistance to Poinsettia mosaic virus.

Clarke JL, et al.  Plant Cell Rep. 2008 Jun;27(6):1027-38. doi: 10.1007/s00299-008-0526-9. Epub 2008 Mar 8.

PMID: 18327592

9

A new virus-induced gene silencing vector based on Euphorbia mosaic virus-Yucatan peninsula for NPR1 silencing in Nicotiana benthamiana and Capsicum annuum var. Anaheim.

Villanueva-Alonzo HJ, et al.  Biotechnol Lett. 2013 May;35(5):811-23. doi: 10.1007/s10529-013-1146-1. Epub 2013 Apr 2.

PMID: 23546940

10

Complete nucleotide sequence of an isolate of Euphorbia mosaic virus that infects Euphorbia heterophylla and Wissadula amplissima in Jamaica.

Collins AM, et al.  Arch Virol. 2009;154(11):1859-60. doi: 10.1007/s00705-009-0508-4. Epub 2009 Sep 23.

PMID: 19774336